Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brume-BMEI1119

Brucella melitensis Brucella suis Brucella abortus (and strain 2308) hypothetical cytosolic protein bmei1119

Comment
Brucella melitensis (M5-90; M28; biotype 1 16M / ATCC 23456 / NCTC 10094; bv. 2 63/9; biotype 2 ATCC 23457; bv. 3 Ethe; bv. 1 Rev.1), Brucella abortus (2308 A; bv. 6 870; bv. 4 292; bv. 3 Tulya; S19; bv. 9 C68; NCTC 8038; bv. 5 B3196; bv. 2 86/8/59), Brucella ceti (M644/93/1; str. Cudo; M13/05/1; B1/94; M490/95/1), Brucella suis (bv. 4 40; bv. 3 686; ATCC 23445 / NCTC 10510; bv. 5 513; biovar 1 1330), Brucella pinnipedialis (M163/99/10; M292/94/1; B2/94), Brucella sp. (BO2; NF 2653; 83/13; NVSL 07-0026; F5/99), Brucella microti (CCM 4915), Brucella canis (ATCC 23365 / NCTC 10854), Brucella inopinata BO1, Brucella neotomae 5K33, Brucella ovis (ATCC 25840 / 63/290 / NCTC 10512)


Relationship
Family|Hydrolase_RBBP9_YdeN
Block| X
Position in NCBI Life Tree|Brucella melitensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella melitensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brume-BMEI1119
Colored MSA for Hydrolase_RBBP9_YdeN (raw)
MKVKDADILIIPGYTNSGPDHWQTRWESKLSTARRVQQAEWSKPVREDWI
GEVVKAANAATRPIVLVAHSLGVATAVHAIPHIQHKVAGAFFVAPPDVSN
EKIRPKHLMTFGPYPRERLPFPTIMVVSRNDPFSSFEAAESVVKDWGALL
IDAGEAGHINAESGHGPWPEGSMVFAEFMTQLQAPKQH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVKDADILIIPGYTNSGPDHWQTRWESKLSTARRVQQAEWSKPVREDWI
GEVVKAANAATRPIVLVAHSLGVATAVHAIPHIQHKVAGAFFVAPPDVSN
EKIRPKHLMTFGPYPRERLPFPTIMVVSRNDPFSSFEAAESVVKDWGALL
IDAGEAGHINAESGHGPWPEGSMVFAEFMTQLQAPKQH


References
6 more
    Title: Completion of the genome sequence of Brucella abortus and comparison to the highly similar genomes of Brucella melitensis and Brucella suis
    Halling SM, Peterson-Burch BD, Bricker BJ, Zuerner RL, Qing Z, Li LL, Kapur V, Alt DP, Olsen SC
    Ref: Journal of Bacteriology, 187:2715, 2005 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: Brucella abortus genes identified following constitutive growth and macrophage infection
    Eskra L, Canavessi A, Carey M, Splitter G
    Ref: Infect Immun, 69:7736, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer