Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brusu-BR0288

Brucella suis, Brucella melitensis, Brucella ovis, Brucella canis, Brucella abortus, Brucella ceti, Brucella microti, Brucella pinnipedialis, Brucella neotomae Brucella sp. hydrolase of the alpha/beta superfamily

Comment
Other strains: Brucella suis (and strain ATCC 23445 / NCTC 10510; bv4 str40; bv5 str513; bv3 str686; bv5 strB3196; 2308) Brucella melitensis (and biotype 2 (strain ATCC 23457); bv1 str16M; bv2 str63/9; bv3 strEther; bv1 strRev.1) Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) Brucella canis (strain ATCC 23365 / NCTC 10854) Brucella abortus (strain S19; 2308 A; bv6 str870; bv4 str292; bv3 strTulya; bv2 str86/8/59; bv9 strC68; NCTC 8038) Brucella ceti (Cudo; M644/93/1; M13/05/1; B1/94; M490/95/1), Brucella microti (strain CCM 4915) Brucella pinnipedialis (B2/94; M292/94/1) Brucella neotomae 5K33 Brucella sp. (F5/99;83/13; NVSL 07-0026; BO1; NF 2653; BO2) Brucella melitensis Q8YF89 BMEI1633 DelVecchio et al identical


Relationship
Family|UCP037442
Block| X
Position in NCBI Life Tree|Brucella suis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella suis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 36 more: AE014341, EQ999594, EQ999608
>3 UniProt links 13 more: D1F6S5, D1CVL2, A5VNN0
>3 UniProt links 10 more: D1CVL2, Q8YF89, A9M7X4
>3 Interpro links 10 more: D1CVL2, Q8YF89, A9M7X4
>3 Pfam links 10 more: D1CVL2, Q8YF89, A9M7X4
>3 PIRSF links 10 more: D1CVL2, Q8YF89, A9M7X4
>3 SUPERFAM links 10 more: D1CVL2, Q8YF89, A9M7X4
Sequence
Graphical view for this peptide sequence: brusu-BR0288
Colored MSA for UCP037442 (raw)
MSETVEFQAEDGISLSGQLFQGTGGKPLVLVSSATAVPQGFYAAFARHLV
DHGARAVLTYDYRGVSASRLTGKSRKPIRFKDWAMLDFPAALRQLQSVEP
GHETVSIGQSFGGQALGISGQSAAFTRYGMVAAMSGALRLLNDRWAWPRM
NLVGVPVSYFTKNMPKWVGGEPIPGTVFRDWARWCRMENYFFDDPHLNAR
ELVAAVRTPIFAIGLDDDPWGTRAAVQHFLDYHVNAPIGQRWYSRKMAGN
QPIGHLGYFRSRFAETLWPEMTGWLLDGKMPDQAEGSTKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSETVEFQAEDGISLSGQLFQGTGGKPLVLVSSATAVPQGFYAAFARHLV
DHGARAVLTYDYRGVSASRLTGKSRKPIRFKDWAMLDFPAALRQLQSVEP
GHETVSIGQSFGGQALGISGQSAAFTRYGMVAAMSGALRLLNDRWAWPRM
NLVGVPVSYFTKNMPKWVGGEPIPGTVFRDWARWCRMENYFFDDPHLNAR
ELVAAVRTPIFAIGLDDDPWGTRAAVQHFLDYHVNAPIGQRWYSRKMAGN
QPIGHLGYFRSRFAETLWPEMTGWLLDGKMPDQAEGSTKG


References
3 more
    Title: Genome sequence of Brucella abortus vaccine strain S19 compared to virulent strains yields candidate virulence genes
    Crasta OR, Folkerts O, Fei Z, Mane SP, Evans C, Martino-Catt S, Bricker B, Yu G, Du L, Sobral BW
    Ref: PLoS ONE, 3:e2193, 2008 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer