Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brusu-BR1327

Brucella suis, Brucella melitensis, Brucella abortus, Brucella sp., Brucella neotomae, Brucella canis, Brucella inopinata, conserved hypothetical protein

Comment
Other strains: Brucella pinnipedialis (M292/94/1; B2/94; M163/99/10), Brucella abortus (2308; bv. 9 C68; bv. 6 870; bv. 4 292; NCTC 8038; bv. 2 str. 86/8/59), Brucella sp. (F5/99; BO2; NVSL 07-0026; 83/13; NF 2653), Brucella melitensis (M28; M5-90; biotype 1 16M / ATCC 23456 / NCTC 10094; bv. 1 Rev.1; bv. 3 Ether; bv. 2 63/9), Brucella microti (CCM 4915), Brucella ceti (B1/94; M490/95/1; M13/05/1; M644/93/1), Brucella suis (ATCC 23445 / NCTC 10510; bv. 3 686; biovar 1 1330; bv. 5 513; bv. 4 40), Brucella neotomae 5K33, Brucella canis (ATCC 23365 / NCTC 10854), Brucella inopinata BO1


Relationship
Family|Hydrolase_RBBP9_YdeN
Block| X
Position in NCBI Life Tree|Brucella suis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella suis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brusu-BR1327
Colored MSA for Hydrolase_RBBP9_YdeN (raw)
MPATLLIPGYKGSEAGHWQRQWLHDDPSALLVEQDDWHYPVLSDWMHMLE
ATLAENPGAVLVAHSLGCVLVAHLASRPAAAHVAGALLVAPADAETMARR
DSRFQSFAPLPRHELGFPSIVVASRNDEYMSFAKAEALSHVWGSGFVDLG
HAGHINVASGFGHWPDGAILASSLHREPAVNPNLPGGLPAPRPFLPGWAA
F
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPATLLIPGYKGSEAGHWQRQWLHDDPSALLVEQDDWHYPVLSDWMHMLE
ATLAENPGAVLVAHSLGCVLVAHLASRPAAAHVAGALLVAPADAETMARR
DSRFQSFAPLPRHELGFPSIVVASRNDEYMSFAKAEALSHVWGSGFVDLG
HAGHINVASGFGHWPDGAILASSLHREPAVNPNLPGGLPAPRPFLPGWAA
F


References
3 more
    Title: Whole-genome analyses of speciation events in pathogenic Brucellae
    Chain PS, Comerci DJ, Tolmasky ME, Larimer FW, Malfatti SA, Vergez LM, Aguero F, Land ML, Ugalde RA, Garcia E
    Ref: Infect Immun, 73:8353, 2005 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer