Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canal-q5afp8

Candida albicans (strain WO-1; SC5314 / ATCC MYA-2876) (Yeast) Carboxypeptidase D hypothetical protein kex1

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Candida albicans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida albicans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AACQ01000024, AP006852, CM000313
2 UniProt : Q5AFP8, C4YTG0
2 UniProt : Q5AFP8, C4YTG0
2 Interpro : Q5AFP8, C4YTG0
2 Prodom : Q5AFP8, C4YTG0
2 Pfam : Q5AFP8, C4YTG0
2 PIRSF : Q5AFP8, C4YTG0
2 SUPERFAM : Q5AFP8, C4YTG0
Sequence
Graphical view for this peptide sequence: canal-q5afp8
Colored MSA for Carboxypeptidase_S10 (raw)
MKLILSTLIVFIHTLLVSALPTKEGSDPNSAKKYLVSDLPGLHENITPDN
SIPLMFAGQLEIYPETDTHYFFWKFSDSNPETVTNRTIFWLNGGPGCSSM
DGALLETGPFRINSQQQVISNNGSWHKMGDIIYVDQPAGTGFSYSDTYIT
DLDQVAEYFLKFMEKYYELFPEEIGYEIYFAGESYAGQYIPYIADAILQR
NKKLVDGEHKYDLRGVLIGNGWVSPNEQSLSYLPFFKDHGLIDVHHPKWA
TLLAKHEQCQKIVNKIDSTFDDGVVHYYEVSSSTCEAILTDLLEYTQDTA
SEKDQRCVNMYDYTLRDSYPSCGMNWPYELVNVGPFLRQEKVMHQLNLIN
LKKWNECNGRVGRTFQARHSIPAVHLLPELAKEIPVMLFNGANDIICNSQ
GVLSYLQKLQWNGETGFTNKDNQISWIYDNKEVGYIIWERNISFINIYNS
SHMVPYDLPDVSRALIDLITGKYDEKDVDGKKSFVT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLILSTLIVFIHTLLVSALPTKEGSDPNSAKKYLVSDLPGLHENITPDN
SIPLMFAGQLEIYPETDTHYFFWKFSDSNPETVTNRTIFWLNGGPGCSSM
DGALLETGPFRINSQQQVISNNGSWHKMGDIIYVDQPAGTGFSYSDTYIT
DLDQVAEYFLKFMEKYYELFPEEIGYEIYFAGESYAGQYIPYIADAILQR
NKKLVDGEHKYDLRGVLIGNGWVSPNEQSLSYLPFFKDHGLIDVHHPKWA
TLLAKHEQCQKIVNKIDSTFDDGVVHYYEVSSSTCEAILTDLLEYTQDTA
SEKDQRCVNMYDYTLRDSYPSCGMNWPYELVNVGPFLRQEKVMHQLNLIN
LKKWNECNGRVGRTFQARHSIPAVHLLPELAKEIPVMLFNGANDIICNSQ
GVLSYLQKLQWNGETGFTNKDNQISWIYDNKEVGYIIWERNISFINIYNS
SHMVPYDLPDVSRALIDLITGKYDEKDVDGKKSFVT


References
    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            

    Title: Sequence finishing and gene mapping for Candida albicans chromosome 7 and syntenic analysis against the Saccharomyces cerevisiae genome
    Chibana H, Oka N, Nakayama H, Aoyama T, Magee BB, Magee PT, Mikami Y
    Ref: Genetics, 170:1525, 2005 : PubMed

            

    Title: The diploid genome sequence of Candida albicans
    Jones T, Federspiel NA, Chibana H, Dungan J, Kalman S, Magee BB, Newport G, Thorstenson YR, Agabian N and Scherer S <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:7329, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer