Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-cbp1

Oryza sativa, subsp. indica subsp. japonica (Rice) and its wild relatives, cbp1 gene for serine carboxypeptidase I

Comment
Other strains: Oryza sativa subsp. indica subsp. japonica (Rice); Oryza officinalis; Oryza barthii; Oryza nivara (Indian wild rice); Oryza eichingeri; Oryza rufipogon (Brownbeard rice) (Asian wild rice); Oryza rhizomatis; Oryza sativa subsp. japonica (Rice); Oryza glaberrima (African rice); Oryza punctata (Red rice)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 19 more: D17586, DP000011, FJ810981
>3 UniProt links 24 more: P37890, E6Y9R4, B8BP32
1 Ncbi-nid : 409579
1 Ncbi-pid : 409580
>3 UniProt links 24 more: P37890, E6Y9R4, B8BP32
>3 Interpro links 24 more: P37890, E6Y9R4, B8BP32
>3 Pfam links 24 more: P37890, E6Y9R4, B8BP32
>3 PIRSF links 24 more: P37890, E6Y9R4, B8BP32
>3 SUPERFAM links 24 more: P37890, E6Y9R4, B8BP32
Sequence
Graphical view for this peptide sequence: orysa-cbp1
Colored MSA for Carboxypeptidase_S10 (raw)
MARRGRRSLASPAVAIALFVFLAYGGGGGGGGVCEAAPASAVVKSVPGFD
GALPSKHYAGYVTVEEQHGRNLFYYLVESERDPAKDPLVLWLNGGPGCSS
FDGFVYEHGPFNFESGGSAKSLPKLHLNPYSWSKVSSVIYLDSPAGVGLS
YSKNTSDYNTGDLKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYV
PTLSHEVVKGLHDGVKPTINFKGYMVGNGVCDTVFDGNALVPFAHGMALI
SDDIYQEAQTACHGNYWNTTTDKCENALYKVDTSINDLNIYDILEPCYHS
KTIKKVTPANTKLPKSFQHLGTTTKPLAVRTRMHGRAWPLRAPVRAGRVP
SWQEFARGSRPSGVPCMSDEVATAWLNNDDVRAAIHAQPVSSIGSWLICT
NVLDFIHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLG
YGVIDSWRPWHLNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQESLAF
YSRWLAGSKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARRGRRSLASPAVAIALFVFLAYGGGGGGGGVCEAAPASAVVKSVPGFD
GALPSKHYAGYVTVEEQHGRNLFYYLVESERDPAKDPLVLWLNGGPGCSS
FDGFVYEHGPFNFESGGSAKSLPKLHLNPYSWSKVSSVIYLDSPAGVGLS
YSKNTSDYNTGDLKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYV
PTLSHEVVKGLHDGVKPTINFKGYMVGNGVCDTVFDGNALVPFAHGMALI
SDDIYQEAQTACHGNYWNTTTDKCENALYKVDTSINDLNIYDILEPCYHS
KTIKKVTPANTKLPKSFQHLGTTTKPLAVRTRMHGRAWPLRAPVRAGRVP
SWQEFARGSRPSGVPCMSDEVATAWLNNDDVRAAIHAQPVSSIGSWLICT
NVLDFIHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLG
YGVIDSWRPWHLNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQESLAF
YSRWLAGSKL


References
3 more
    Title: Genetic diversity and domestication history of African rice (Oryza glaberrima) as inferred from multiple gene sequences
    Li ZM, Zheng XM, Ge S
    Ref: Theor Appl Genet, 123:21, 2011 : PubMed

            

    Title: Cloning and sequencing of the gene for type I carboxypeptidase in rice
    Washio K, Ishikawa K
    Ref: Biochimica & Biophysica Acta, 1199:311, 1994 : PubMed

            

    Title: Organ-specific and hormone-dependent expression of genes for serine carboxypeptidases during development and following germination of rice grains
    Washio K, Ishikawa K
    Ref: Plant Physiol, 105:1275, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer