Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plaf7-q8iik5

Plasmodium falciparum (isolate 3D7) PF3D7_1116100 Serine esterase, putative PF11_0168a

Comment
only central part Pfam A DUF676 782 869 other RON4


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Plasmodium falciparum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Laverania): N E > Plasmodium falciparum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: Sal-A-alkyne, Salinipostin-A
3 Genbank : AE014838, CZT98821, XP_002585429
2 UniProt : Q8IIK5, C6S3F2
2 UniProt : Q8IIK5, C6S3F2
2 Interpro : Q8IIK5, C6S3F2
2 Prodom : Q8IIK5, C6S3F2
2 Pfam : Q8IIK5, C6S3F2
2 PIRSF : Q8IIK5, C6S3F2
2 SUPERFAM : Q8IIK5, C6S3F2
Sequence
Graphical view for this peptide sequence: plaf7-q8iik5
Colored MSA for Duf_676 (raw)
KLKNPHYFIFQHGLTASVHDFQNIFNSLLTKYPHVFVYVTYSNQGHTFEG
VDVGTERICTELNCLFKIINDKINISMIGHSLGGILNRSVLLNLNRKKIF
KNKKLINFITFACPHIGVHENMAIMKVLSTYLGAHTIDDLNNKTTLLLKI
ASVESINILKKFENIIFYGNTQSDWLVGIRTSLILPYTLFNEELILFIIE
QAKNVPEIPI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KLKNPHYFIFQHGLTASVHDFQNIFNSLLTKYPHVFVYVTYSNQGHTFEG
VDVGTERICTELNCLFKIINDKINISMIGHSLGGILNRSVLLNLNRKKIF
KNKKLINFITFACPHIGVHENMAIMKVLSTYLGAHTIDDLNNKTTLLLKI
ASVESINILKKFENIIFYGNTQSDWLVGIRTSLILPYTLFNEELILFIIE
QAKNVPEIPI


References
    Title: The Antimalarial Natural Product Salinipostin A Identifies Essential alpha/beta Serine Hydrolases Involved in Lipid Metabolism in P. falciparum Parasites
    Yoo E, Schulze CJ, Stokes BH, Onguka O, Yeo T, Mok S, Gnadig NF, Zhou Y, Kurita K and Bogyo M <11 more author(s)>
    Ref: Cell Chemical Biology, 27:143, 2020 : PubMed

            

    Title: Functional annotation of serine hydrolases in the asexual erythrocytic stage of Plasmodium falciparum
    Elahi R, Ray WK, Dapper C, Dalal S, Helm RF, Klemba M
    Ref: Sci Rep, 9:17532, 2019 : PubMed

            

    Title: Genome sequence of the human malaria parasite Plasmodium falciparum
    Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE and Barrell B <35 more author(s)>
    Ref: Nature, 419:498, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer