Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plafa-PFD0185C

Plasmodium falciparum (isolate 3D7) PF3D7_0403800 hypothetical protein, conserved

Comment
Long C-term extension with repeated NNNN stretch


Relationship
Family|ABHD17-depalmitoylase
Block| X
Position in NCBI Life Tree|Plasmodium falciparum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Laverania): N E > Plasmodium falciparum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL034557
1 UniProt : Q8I1Z1
1 Interpro : Q8I1Z1
1 Prodom : Q8I1Z1
1 Pfam : Q8I1Z1
1 PIRSF : Q8I1Z1
1 SUPERFAM : Q8I1Z1
Sequence
Graphical view for this peptide sequence: plafa-PFD0185C
Colored MSA for ABHD17-depalmitoylase (raw)
MGNALNQLIFRPHPPSYSKNRKNLHFIKTKHGSTICGIFLNNNAHLTILF
SHGNAEDIGDIVPQFESKLKRLGLNMFAYDYSGYGQSTGYPTETHLYNDV
EAAYNYLISELNISKECIIAYGRSLGSAASVHIATKRDLLGLVLQCPLSS
IHRVKLRLKFTLPYDLFCNIDKVHLIKCPILFIHGKKDKLLSYHGTEEMI
TKTKVNTYFMFIDEGGHNNLDSCFGNKMTAALVTFLFVLKNNIRENVNSV
YDISNINTQKLRNMFILNNTEKLKDKLKEKIGDKEEKKDLTSKIKKNEKV
IINNKIPKIKKDVNSYYYSSMEGIGSSTQNICKVQSSTESSYNSLTSVST
ILASIESIMKGIPDSNTLCEKNSVQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNALNQLIFRPHPPSYSKNRKNLHFIKTKHGSTICGIFLNNNAHLTILF
SHGNAEDIGDIVPQFESKLKRLGLNMFAYDYSGYGQSTGYPTETHLYNDV
EAAYNYLISELNISKECIIAYGRSLGSAASVHIATKRDLLGLVLQCPLSS
IHRVKLRLKFTLPYDLFCNIDKVHLIKCPILFIHGKKDKLLSYHGTEEMI
TKTKVNTYFMFIDEGGHNNLDSCFGNKMTAALVTFLFVLKNNIRENVNSV
YDISNINTQKLRNMFILNNTEKLKDKLKEKIGDKEEKKDLTSKIKKNEKV
IINNKIPKIKKDVNSYYYSSMEGIGSSTQNICKVQSSTESSYNSLTSVST
ILASIESIMKGIPDSNTLCEKNSVQ


References
    Title: Functional annotation of serine hydrolases in the asexual erythrocytic stage of Plasmodium falciparum
    Elahi R, Ray WK, Dapper C, Dalal S, Helm RF, Klemba M
    Ref: Sci Rep, 9:17532, 2019 : PubMed

            

    Title: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13
    Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R and Barrell BG <70 more author(s)>
    Ref: Nature, 419:527, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer