Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trica-ACHE1

Tribolium castaneum (Red flour beetle) Putative uncharacterized protein

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Tribolium castaneum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Coleoptera: N E > Polyphaga: N E > Cucujiformia: N E > Tenebrionoidea: N E > Tenebrionidae: N E > Tenebrionidae incertae sedis: N E > Tribolium: N E > Tribolium castaneum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CM000280, HQ260968, ADU33189
2 UniProt : D6WLS4, E7DN61
2 UniProt : D6WLS4, E7DN61
2 Interpro : D6WLS4, E7DN61
2 Prodom : D6WLS4, E7DN61
2 Pfam : D6WLS4, E7DN61
2 PIRSF : D6WLS4, E7DN61
2 SUPERFAM : D6WLS4, E7DN61
Sequence
Graphical view for this peptide sequence: trica-ACHE1
Colored MSA for ACHE (raw)
MTGAWAACLLVILLPSCIPSPHRGRHHPPEPHAEAYHMSRDPFDPHRDSE
EFRRDAPDDKREFTRRDSEDDPLVIQTKKGKVRGISLTAATGKKVDAWLG
IPYAQKPLGNLRFRHPRPAEKWEGVMNTTSQPNSCVQIIDTVFGDFPGAT
MWNPNTPLNEDCLYVNVVVPKPRPTSAAVMVWVFGGGFYSGTNTLEVYDH
NILVSEENIILVSMQYRVASLGFLYFGTPDVPGNAGLFDQMMALQWVRDN
IAAFGGNPNNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMESGSATAPW
AIISREESILRGLRLAEAVGCPHERHELSAVIDCLKKKDPIDLVNNEWGT
LGICEFPFVPVIDGAFLDESPTRALANKNFKKTNILMGSNTEEGYYFIIY
YLTELFRKEENVYVNRQEFLRAVTELNPYFNAISRQAIVFEYTNWLNPDD
PVSNRDSLDKMVGDYHFTCNVNEFAHRYAETGNTVYMYYYKHRTVANPWP
SWTGVMHADEINYVFGEPLNPTKSYTAQEVDLSKRIMRYWANFAKTGNPS
QSPNGVWTPTFWPPHTAFGREFLTLDVNSTATGRGPRLKQCAFWKKYLPQ
LQQQTSELLNQPPRQNCTDAASSLRWSRDGAAGLLMVSTVAALLAGPF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTGAWAACLLVILLPSCIPSPHRGRHHPPEPHAEAYHMSRDPFDPHRDSE
EFRRDAPDDKREFTRRDSEDDPLVIQTKKGKVRGISLTAATGKKVDAWLG
IPYAQKPLGNLRFRHPRPAEKWEGVMNTTSQPNSCVQIIDTVFGDFPGAT
MWNPNTPLNEDCLYVNVVVPKPRPTSAAVMVWVFGGGFYSGTNTLEVYDH
NILVSEENIILVSMQYRVASLGFLYFGTPDVPGNAGLFDQMMALQWVRDN
IAAFGGNPNNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMESGSATAPW
AIISREESILRGLRLAEAVGCPHERHELSAVIDCLKKKDPIDLVNNEWGT
LGICEFPFVPVIDGAFLDESPTRALANKNFKKTNILMGSNTEEGYYFIIY
YLTELFRKEENVYVNRQEFLRAVTELNPYFNAISRQAIVFEYTNWLNPDD
PVSNRDSLDKMVGDYHFTCNVNEFAHRYAETGNTVYMYYYKHRTVANPWP
SWTGVMHADEINYVFGEPLNPTKSYTAQEVDLSKRIMRYWANFAKTGNPS
QSPNGVWTPTFWPPHTAFGREFLTLDVNSTATGRGPRLKQCAFWKKYLPQ
LQQQTSELLNQPPRQNCTDAASSLRWSRDGAAGLLMVSTVAALLAGPF


References
    Title: BeetleBase in 2010: revisions to provide comprehensive genomic information for Tribolium castaneum
    Kim HS, Murphy T, Xia J, Caragea D, Park Y, Beeman RW, Lorenzen MD, Butcher S, Manak JR, Brown SJ
    Ref: Nucleic Acids Research, 38:D437, 2010 : PubMed

            

    Title: The genome of the model beetle and pest Tribolium castaneum
    Richards S, Gibbs RA, Weinstock GM, Brown SJ, Denell R, Beeman RW, Gibbs R, Bucher G, Friedrich M and Grossmann D <181 more author(s)>
    Ref: Nature, 452:949, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer