Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-XAC2532

Xanthomonas axonopodis (pv. citri), Xanthomonas campestris pv. vesicatoria, Xanthomonas fuscans subsp. aurantifolii, Xanthomonas perforans, peptidase

Comment
Other species: Xanthomonas axonopodis (pv. citri) and Xanthomonas campestris pv. vesicatoria (strain 85-10), Xanthomonas fuscans subsp. aurantifolii (str. ICPB 11122; ICPB 10535), Xanthomonas perforans 91-118 Xanthomonas campestris pv. vesicatoria


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AE011892, AM039952, ACPX01000137
2 UniProt : Q3BS06, D4TAY5
3 UniProt : Q8PJJ9, Q3BS06, D4TAY5
3 Interpro : Q8PJJ9, Q3BS06, D4TAY5
3 Pfam : Q8PJJ9, Q3BS06, D4TAY5
3 PIRSF : Q8PJJ9, Q3BS06, D4TAY5
3 SUPERFAM : Q8PJJ9, Q3BS06, D4TAY5
Sequence
Graphical view for this peptide sequence: xanax-XAC2532
Colored MSA for DPP4N_Peptidase_S9 (raw)
MRSQMPHIPAMRLRTIPIWCVSLALAHIVPVAAAPLPAPTPTQYTQAMGL
SDHYASLVDRQPTAPVWVDAGHFLYRRGVARSKQLPAIEYRLVEAASGRN
TLAFDHARLAAALTQAGAKAVDAARLQLDEPTLEQQRLSFQLAKLGWQCD
LLRYRCAHLPERNLPAESMDMRLPLKQGERQAMLSPDGRWRAWVEQGNLV
IAPVGSHERSVLSHDGSTDDYYALDSVVWSPDSQHLAAYRVKAPPPRMVY
YIESAPADQVQPKLHQQVYPKPGDVLPMMQPVLFDVATHAAHPVAMTLLP
NAFALSEMVWWKDSRGFTFEYNARGHQLYRVIEVDARTAAARTLIEETSP
TFIEYSELSGEHENGGKHARQDLDDGAQIVWASERDGWEHLYLYDGRSGE
VIRQITRGDWVVRKLDRIDEAAGQVYFTASGMQPGEDPYYRHAYRIGLDG
RGLTALTPLAADHEVRYSPDGRWLLDLYSRVDLGPVLELRRSADGSVART
VERTDLSRLLAAGWQAPLPFHTTGRDGRTEIWGVIHRPQQLDPQQRYRVV
EDIYAGPQGSFVPKSFTTTTPSLTGMGFAVASIDGMGTNNRSRAFHDVAW
RNLKDAGLPDRIAWHKAAAAQYPWYDIDGGVGVYGTSAGGQNALGALLFH
PEFYVAGVANSGCHDNRMDKIWWNEQWMGWPVGPWYAASSNVENAARLQG
HLLLVTGDMDMNVDPASTFQVADRLIKAGKDFDLLVVPGGDHGAGGDYGR
RRLLDFFLRWMQQAPTPEWNRTAAAPAAPAP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSQMPHIPAMRLRTIPIWCVSLALAHIVPVAAAPLPAPTPTQYTQAMGL
SDHYASLVDRQPTAPVWVDAGHFLYRRGVARSKQLPAIEYRLVEAASGRN
TLAFDHARLAAALTQAGAKAVDAARLQLDEPTLEQQRLSFQLAKLGWQCD
LLRYRCAHLPERNLPAESMDMRLPLKQGERQAMLSPDGRWRAWVEQGNLV
IAPVGSHERSVLSHDGSTDDYYALDSVVWSPDSQHLAAYRVKAPPPRMVY
YIESAPADQVQPKLHQQVYPKPGDVLPMMQPVLFDVATHAAHPVAMTLLP
NAFALSEMVWWKDSRGFTFEYNARGHQLYRVIEVDARTAAARTLIEETSP
TFIEYSELSGEHENGGKHARQDLDDGAQIVWASERDGWEHLYLYDGRSGE
VIRQITRGDWVVRKLDRIDEAAGQVYFTASGMQPGEDPYYRHAYRIGLDG
RGLTALTPLAADHEVRYSPDGRWLLDLYSRVDLGPVLELRRSADGSVART
VERTDLSRLLAAGWQAPLPFHTTGRDGRTEIWGVIHRPQQLDPQQRYRVV
EDIYAGPQGSFVPKSFTTTTPSLTGMGFAVASIDGMGTNNRSRAFHDVAW
RNLKDAGLPDRIAWHKAAAAQYPWYDIDGGVGVYGTSAGGQNALGALLFH
PEFYVAGVANSGCHDNRMDKIWWNEQWMGWPVGPWYAASSNVENAARLQG
HLLLVTGDMDMNVDPASTFQVADRLIKAGKDFDLLVVPGGDHGAGGDYGR
RRLLDFFLRWMQQAPTPEWNRTAAAPAAPAP


References
1 more
    Title: Novel insights into the genomic basis of citrus canker based on the genome sequences of two strains of Xanthomonas fuscans subsp. aurantifolii
    Moreira LM, Almeida NF, Jr., Potnis N, Digiampietri LA, Adi SS, Bortolossi JC, da Silva AC, da Silva AM, de Moraes FE and Setubal JC <21 more author(s)>
    Ref: BMC Genomics, 11:238, 2010 : PubMed

            

    Title: Insights into genome plasticity and pathogenicity of the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete genome sequence
    Thieme F, Koebnik R, Bekel T, Berger C, Boch J, Buttner D, Caldana C, Gaigalat L, Goesmann A and Kaiser O <19 more author(s)>
    Ref: Journal of Bacteriology, 187:7254, 2005 : PubMed

            

    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer