Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yerpe-PIP

Yersinia pestis Yersinia pseudotuberculosis proline iminopeptidase (EC 3.4.11.5)

Comment
Other strains: Yersinia pestis (strains D182038; D106004; KIM D27; Z176003; Pestoides(A; F); CA88-4125; biovar Medievalis (strains: Harbin 35; K1973002; biovar Antiqua (strains: E1979001; UG05-0454; B42003004; Angola; Antiqua; Nepal516); biovar Orientalis (strains: IP275; MG05-1020; PEXU2; F1991016; India 195), Yersinia pseudotuberculosis (serotype IB PB1/+; serotype O:3 YPIII; serotype O:1b IP 31758)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BX936398, AJ414150, AE013855
2 UniProt : Q66BV9, Q7CHW8
2 UniProt : Q7CHW8, Q66BV9
2 Interpro : Q7CHW8, Q66BV9
2 Prodom : Q7CHW8, Q66BV9
2 Pfam : Q7CHW8, Q66BV9
2 PIRSF : Q7CHW8, Q66BV9
2 SUPERFAM : Q7CHW8, Q66BV9
Sequence
Graphical view for this peptide sequence: yerpe-PIP
Colored MSA for Proline_iminopeptidase (raw)
MEQLRGLYPAYEPYDSGLLDTGDGHQIYWELCGNPKGKPAIFIHGGPGGG
IAPYHRQLFNPAKYNVMLFDQRGCGRSKPHASLDNNTTWHLVEDIERLRK
MAGIEQWLVFGGSWGSTLALAYGETHPERVSEMVLRGIFTLRRKELHWYY
QEGASRFFPEKWQRVLSILSPEEQGDVIAAYRKRLTSPDRAIQLEAAKIW
SLWEGETVTLLPTKSSASFGEEHFALAFARIENHYFTHLGFLDSDNQLLD
NVTRIRHIPAVIIHGRYDMACQLQNAWDLAQAWPEAELYIVEGAGHSFDE
PGILHQLILATDKFAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEQLRGLYPAYEPYDSGLLDTGDGHQIYWELCGNPKGKPAIFIHGGPGGG
IAPYHRQLFNPAKYNVMLFDQRGCGRSKPHASLDNNTTWHLVEDIERLRK
MAGIEQWLVFGGSWGSTLALAYGETHPERVSEMVLRGIFTLRRKELHWYY
QEGASRFFPEKWQRVLSILSPEEQGDVIAAYRKRLTSPDRAIQLEAAKIW
SLWEGETVTLLPTKSSASFGEEHFALAFARIENHYFTHLGFLDSDNQLLD
NVTRIRHIPAVIIHGRYDMACQLQNAWDLAQAWPEAELYIVEGAGHSFDE
PGILHQLILATDKFAH


References
7 more
    Title: Insights into the evolution of Yersinia pestis through whole-genome comparison with Yersinia pseudotuberculosis
    Chain PS, Carniel E, Larimer FW, Lamerdin J, Stoutland PO, Regala WM, Georgescu AM, Vergez LM, Land ML and Garcia E <13 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:13826, 2004 : PubMed

            

    Title: Complete genome sequence of Yersinia pestis strain 91001, an isolate avirulent to humans
    Song Y, Tong Z, Wang J, Wang L, Guo Z, Han Y, Zhang J, Pei D, Zhou D and Yang R <16 more author(s)>
    Ref: DNA Research, 11:179, 2004 : PubMed

            

    Title: Genome sequence of Yersinia pestis, the causative agent of plague.
    Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MTG, Prentice MB, Sebaihia M, James KD, Churcher C and Barrell BG <25 more author(s)>
    Ref: Nature, 413:523, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer