Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yerpe-YPO0986

Yersinia pestis putative exported protein (hypothetical)

Comment
Other strains: Yersinia pestis (Z176003; CA88-4125; D182038; Pestoides A; Pestoides F; D106004; KIM D27; biovars: Mediaevalis (K1973002; Harbin 35), Antiqua (E1979001; Nepal516; UG05-0454; Angola; Antiqua; B42003004), Orientalis (India 195; F1991016; IP275; MG05-1020; PEXU2)), Yersinia pseudotuberculosis serotypes (O:1b IP 31758; IB PB1/+; O:3 YPIII; I IP32953) only central part Pfam A Esterase_phd 199 346


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AJ414145, AE013939
2 UniProt : Q666J6, Q7CGP1
2 UniProt : Q666J6, Q7CGP1
2 Interpro : Q666J6, Q7CGP1
2 Pfam : Q666J6, Q7CGP1
2 PIRSF : Q666J6, Q7CGP1
2 SUPERFAM : Q666J6, Q7CGP1
Sequence
Graphical view for this peptide sequence: yerpe-YPO0986
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGIRLTAV
AVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIAL
SPDDKNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQAT
VLRLPSVHTASGDTLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLK
YNLFIPKDYSPDKDYSPDKNYSPDKAWPLVLFMHDAGATSDVTRTTLYQG
LGAIAWASPEDQAQRPCFVLAPQYEEIIADDDSKTSDMLDTTIDLINVLS
EQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVAGQWDPALVKP
LAQQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQFR
QAFEQIEAEKSPINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIR
EWIFRQQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGIRLTAV
AVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIAL
SPDDKNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQAT
VLRLPSVHTASGDTLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLK
YNLFIPKDYSPDKDYSPDKNYSPDKAWPLVLFMHDAGATSDVTRTTLYQG
LGAIAWASPEDQAQRPCFVLAPQYEEIIADDDSKTSDMLDTTIDLINVLS
EQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVAGQWDPALVKP
LAQQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQFR
QAFEQIEAEKSPINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIR
EWIFRQQR


References
7 more
    Title: Draft genome sequences of Yersinia pestis isolates from natural foci of endemic plague in China
    Eppinger M, Guo Z, Sebastian Y, Song Y, Lindler LE, Yang R, Ravel J
    Ref: Journal of Bacteriology, 191:7628, 2009 : PubMed

            

    Title: Genome sequence of Yersinia pestis KIM
    Deng W, Burland V, Plunkett G, 3rd, Boutin A, Mayhew GF, Liss P, Perna NT, Rose DJ, Mau B and Perry RD <11 more author(s)>
    Ref: Journal of Bacteriology, 184:4601, 2002 : PubMed

            

    Title: Genome sequence of Yersinia pestis, the causative agent of plague.
    Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MTG, Prentice MB, Sebaihia M, James KD, Churcher C and Barrell BG <25 more author(s)>
    Ref: Nature, 413:523, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer