human-ABHD2

Homo sapiens (Human) Monoacylglycerol lipase ABHD2 LABH2 LBH2 protein phps1-2

Comment

"Monoacylglycerol lipase ABHD2 Enhanced neointimal hyperplasia was observed in Abhd2-deficient mice, using an experimental vascular cuff placement injury model. Abhd2 is expressed in vascular smooth muscle cells (SMCs). An association between the human ABHD2 gene and colorectal cancer and with Risks for Chronic Obstructive Pulmonary Disease is reported. ABHD2 is a steroid-activated (progesterone P4) enzyme that hydrolyzes 2-arachidonoylglycerol. ABHD2 is expressed in sperm and in ovaries"

Relationship

Family : abh_upf0017

Block : X

Position in NCBI Life Tree : Homo sapiens

Molecular evidence

No mutation

No structure

No kinetic

No disease

Database

Sequence

Peptide

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTA
PPDLYFQDSG LSRFLLKSCPLLTKEYIPPLIWGKSGHIQ
TALYGKMGRVRSPHPYGHRKF ITMSDGATSTFDLFEPLA
EHCVGDDITMVICPGIANHSEKQYIRTFVDYA QKNGYRC
AVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYP
LTQ LVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQG
YSALRAQETFMQWD QCRRFYNFLMADNMKKIILSHRQAL
FGDHVKKPQSLEDTDLSRLYTATSL MQIDDNVMRKFHGY
NSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE SLL
TIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWM
DKLVVEY ANAICQWERNKLQCSDTEQVEADLE

References

Title : Abhd2, a Candidate Gene Regulating Airway Remodeling in COPD via TGF-beta - Lv_2024_Int.J.Chron.Obstruct.Pulmon.Dis_19_33
Author(s) : Lv MY , Jin LL , Sang XQ , Shi WC , Qiang LX , Lin QY , Jin SD
Ref : Int J Chron Obstruct Pulmon Dis , 19 :33 , 2024
Abstract : Lv_2024_Int.J.Chron.Obstruct.Pulmon.Dis_19_33
ESTHER : Lv_2024_Int.J.Chron.Obstruct.Pulmon.Dis_19_33
PubMedSearch : Lv_2024_Int.J.Chron.Obstruct.Pulmon.Dis_19_33
PubMedID: 38197032
Gene_locus related to this paper: human-ABHD2

Title : Progesterone induces meiosis through two obligate co-receptors with PLA2 activity - Nader_2023_bioRxiv__
Author(s) : Nader N , Zarif L , Halama A , Yadav S , Dib M , Attarwala N , Chen Q , Suhre K , Gross SS , Machaca K
Ref : Biorxiv , : , 2023
Abstract : Nader_2023_bioRxiv__
ESTHER : Nader_2023_bioRxiv__
PubMedSearch : Nader_2023_bioRxiv__
PubMedID: 37905030
Gene_locus related to this paper: human-ABHD2

Title : Lipidomic QTL in Diversity Outbred mice identifies a novel function for alpha\/beta hydrolase domain 2 (Abhd2) as an enzyme that metabolizes phosphatidylcholine and cardiolipin - Price_2023_PLoS.Genet_19_e1010713
Author(s) : Price TR , Stapleton DS , Schueler KL , Norris MK , Parks BW , Yandell BS , Churchill GA , Holland WL , Keller MP , Attie AD
Ref : PLoS Genet , 19 :e1010713 , 2023
Abstract : Price_2023_PLoS.Genet_19_e1010713
ESTHER : Price_2023_PLoS.Genet_19_e1010713
PubMedSearch : Price_2023_PLoS.Genet_19_e1010713
PubMedID: 37523383
Gene_locus related to this paper: human-ABHD2 , mouse-ABHD2

Title : Lipidomic QTL in Diversity Outbred mice identifies a novel function for alpha\/beta hydrolase domain 2 (Abhd2) as an enzyme that metabolizes phosphatidylcholine and cardiolipin - Price_2023_bioRxiv__
Author(s) : Price TR , Stapleton DS , Schueler KL , Norris MK , Parks BW , Yandell BS , Churchill GA , Holland WL , Keller MP , Attie AD
Ref : Biorxiv , : , 2023
Abstract : Price_2023_bioRxiv__
ESTHER : Price_2023_bioRxiv__
PubMedSearch : Price_2023_bioRxiv__
PubMedID: 36993241
Gene_locus related to this paper: human-ABHD2 , mouse-ABHD2

Title : Radiometric Assay of ABHD2 Activity - Fazio_2023_Methods.Mol.Biol_2576_299
Author(s) : Fazio D , Criscuolo E , Maccarrone M
Ref : Methods Mol Biol , 2576 :299 , 2023
Abstract : Fazio_2023_Methods.Mol.Biol_2576_299
ESTHER : Fazio_2023_Methods.Mol.Biol_2576_299
PubMedSearch : Fazio_2023_Methods.Mol.Biol_2576_299
PubMedID: 36152197
Gene_locus related to this paper: human-ABHD2

Title : Progesterone activates the cyclic AMP-protein kinase A signalling pathway by upregulating ABHD2 in fertile men - Jiang_2021_J.Int.Med.Res_49_300060521999527
Author(s) : Jiang F , Zhu Y , Chen Y , Tang X , Liu L , Chen G , Liu Y , Sun X
Ref : J Internal Medicine Res , 49 :300060521999527 , 2021
Abstract : Jiang_2021_J.Int.Med.Res_49_300060521999527
ESTHER : Jiang_2021_J.Int.Med.Res_49_300060521999527
PubMedSearch : Jiang_2021_J.Int.Med.Res_49_300060521999527
PubMedID: 33752482
Gene_locus related to this paper: human-ABHD2

Title : Alpha\/Beta Hydrolase Domain-Containing Protein 2 regulates the rhythm of follicular maturation and estrous stages of the female reproductive cycle - Bjorkgren_2021_Front.Cell.Dev.Biol_9_710864
Author(s) : Bjorkgren I , Chung DH , Mendoza S , Gabelev-Khasin L , Modzelewski A , He L , Lishko PV
Ref : Front Cell Developmental Biology , 9 :710864 , 2021
Abstract : Bjorkgren_2021_Front.Cell.Dev.Biol_9_710864
ESTHER : Bjorkgren_2021_Front.Cell.Dev.Biol_9_710864
PubMedSearch : Bjorkgren_2021_Front.Cell.Dev.Biol_9_710864
PubMedID: 34568325
Gene_locus related to this paper: human-ABHD2 , mouse-ABHD2

Title : miR-140-3p Inhibits Cutaneous Melanoma Progression by Disrupting AKT\/p70S6K and JNK Pathways through ABHD2 - He_2020_Mol.Ther.Oncolytics_17_83
Author(s) : He Y , Yang Y , Liao Y , Xu J , Liu L , Li C , Xiong X
Ref : Mol Ther Oncolytics , 17 :83 , 2020
Abstract : He_2020_Mol.Ther.Oncolytics_17_83
ESTHER : He_2020_Mol.Ther.Oncolytics_17_83
PubMedSearch : He_2020_Mol.Ther.Oncolytics_17_83
PubMedID: 32322665
Gene_locus related to this paper: human-ABHD2

Title : Retinoic Acid Induces Differentiation of Mouse F9 Embryonic Carcinoma Cell by Modulating the miR-485 Targeting of Abhd2 - Yu_2019_Int.J.Mol.Sci_20_
Author(s) : Yu M , Zhang L , Liu Y , Liu D , Guo Z
Ref : Int J Mol Sci , 20 : , 2019
Abstract : Yu_2019_Int.J.Mol.Sci_20_
ESTHER : Yu_2019_Int.J.Mol.Sci_20_
PubMedSearch : Yu_2019_Int.J.Mol.Sci_20_
PubMedID: 31035455
Gene_locus related to this paper: human-ABHD2

Title : ABHD2 Inhibitor Identified by Activity-Based Protein Profiling Reduces Acrosome Reaction - Baggelaar_2019_ACS.Chem.Biol_14_2295
Author(s) : Baggelaar MP , den Dulk H , Florea BI , Fazio D , Perruzza D , Bernabo N , Raspa M , Janssen APA , Scavizzi F , Barboni B , Overkleeft HS , Maccarrone M , van der Stelt M
Ref : ACS Chemical Biology , 14 :2295 , 2019
Abstract : Baggelaar_2019_ACS.Chem.Biol_14_2295
ESTHER : Baggelaar_2019_ACS.Chem.Biol_14_2295
PubMedSearch : Baggelaar_2019_ACS.Chem.Biol_14_2295
PubMedID: 31525885
Gene_locus related to this paper: human-ABHD2 , human-ABHD3

Title : Characterisation and localisation of the endocannabinoid system components in the adult human testis - Nielsen_2019_Sci.Rep_9_12866
Author(s) : Nielsen JE , Rolland AD , Rajpert-De Meyts E , Janfelt C , Jorgensen A , Winge SB , Kristensen DM , Juul A , Chalmel F , Jegou B , Skakkebaek NE
Ref : Sci Rep , 9 :12866 , 2019
Abstract : Nielsen_2019_Sci.Rep_9_12866
ESTHER : Nielsen_2019_Sci.Rep_9_12866
PubMedSearch : Nielsen_2019_Sci.Rep_9_12866
PubMedID: 31537814
Gene_locus related to this paper: human-ABHD2 , human-MGLL

Title : Asymmetrically Positioned Flagellar Control Units Regulate Human Sperm Rotation - Miller_2018_Cell.Rep_24_2606
Author(s) : Miller MR , Kenny SJ , Mannowetz N , Mansell SA , Wojcik M , Mendoza S , Zucker RS , Xu K , Lishko PV
Ref : Cell Rep , 24 :2606 , 2018
Abstract : Miller_2018_Cell.Rep_24_2606
ESTHER : Miller_2018_Cell.Rep_24_2606
PubMedSearch : Miller_2018_Cell.Rep_24_2606
PubMedID: 30184496
Gene_locus related to this paper: human-ABHD2

Title : Regulation of the sperm calcium channel CatSper by endogenous steroids and plant triterpenoids - Mannowetz_2017_Proc.Natl.Acad.Sci.U.S.A_114_5743
Author(s) : Mannowetz N , Miller MR , Lishko PV
Ref : Proc Natl Acad Sci U S A , 114 :5743 , 2017
Abstract : Mannowetz_2017_Proc.Natl.Acad.Sci.U.S.A_114_5743
ESTHER : Mannowetz_2017_Proc.Natl.Acad.Sci.U.S.A_114_5743
PubMedSearch : Mannowetz_2017_Proc.Natl.Acad.Sci.U.S.A_114_5743
PubMedID: 28507119
Gene_locus related to this paper: human-ABHD2

Title : Regulation of calcium release from the endoplasmic reticulum by the serine hydrolase ABHD2 - Yun_2017_Biochem.Biophys.Res.Commun_490_1226
Author(s) : Yun B , Lee H , Powell R , Reisdorph N , Ewing H , Gelb MH , Hsu KL , Cravatt BF , Leslie CC
Ref : Biochemical & Biophysical Research Communications , 490 :1226 , 2017
Abstract : Yun_2017_Biochem.Biophys.Res.Commun_490_1226
ESTHER : Yun_2017_Biochem.Biophys.Res.Commun_490_1226
PubMedSearch : Yun_2017_Biochem.Biophys.Res.Commun_490_1226
PubMedID: 28684316
Gene_locus related to this paper: human-ABHD2

Title : Abhydrolase domain containing 2, an androgen target gene, promotes prostate cancer cell proliferation and migration - Obinata_2016_Eur.J.Cancer_57_39
Author(s) : Obinata D , Takada S , Takayama K , Urano T , Ito A , Ashikari D , Fujiwara K , Yamada Y , Murata T , Kumagai J , Fujimura T , Ikeda K , Horie-Inoue K , Homma Y , Takahashi S , Inoue S
Ref : Eur J Cancer , 57 :39 , 2016
Abstract : Obinata_2016_Eur.J.Cancer_57_39
ESTHER : Obinata_2016_Eur.J.Cancer_57_39
PubMedSearch : Obinata_2016_Eur.J.Cancer_57_39
PubMedID: 26854828
Gene_locus related to this paper: human-ABHD2

Title : Molecular characterization of human ABHD2 as TAG lipase and ester hydrolase - Manda_2016_Biosci.Rep_36_
Author(s) : Manda NK , Thunuguntla VBSC , Veeramachaneni GK , Bokka CS , Guntupalli S , Bondili JS
Ref : Bioscience Reports , 36 : , 2016
Abstract : Manda_2016_Biosci.Rep_36_
ESTHER : Manda_2016_Biosci.Rep_36_
PubMedSearch : Manda_2016_Biosci.Rep_36_
PubMedID: 27247428
Gene_locus related to this paper: human-ABHD2

Title : Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone - Miller_2016_Science_352_555
Author(s) : Miller MR , Mannowetz N , Iavarone AT , Safavi R , Gracheva EO , Smith JF , Hill RZ , Bautista DM , Kirichok Y , Lishko PV
Ref : Science , 352 :555 , 2016
Abstract : Miller_2016_Science_352_555
ESTHER : Miller_2016_Science_352_555
PubMedSearch : Miller_2016_Science_352_555
PubMedID: 26989199
Gene_locus related to this paper: human-ABHD2

Title : Associations of ABHD2 Genetic Variations with Risks for Chronic Obstructive Pulmonary Disease in a Chinese Han Population - Liu_2015_PLoS.One_10_e0123929
Author(s) : Liu L , Li X , Yuan R , Zhang H , Qiang L , Shen J , Jin S
Ref : PLoS ONE , 10 :e0123929 , 2015
Abstract : Liu_2015_PLoS.One_10_e0123929
ESTHER : Liu_2015_PLoS.One_10_e0123929
PubMedSearch : Liu_2015_PLoS.One_10_e0123929
PubMedID: 25880496
Gene_locus related to this paper: human-ABHD2

Title : Age-related pulmonary emphysema in mice lacking alpha\/beta hydrolase domain containing 2 gene - Jin_2009_Biochem.Biophys.Res.Commun_380_419
Author(s) : Jin S , Zhao G , Li Z , Nishimoto Y , Isohama Y , Shen J , Ito T , Takeya M , Araki K , He P , Yamamura K
Ref : Biochemical & Biophysical Research Communications , 380 :419 , 2009
Abstract : Jin_2009_Biochem.Biophys.Res.Commun_380_419
ESTHER : Jin_2009_Biochem.Biophys.Res.Commun_380_419
PubMedSearch : Jin_2009_Biochem.Biophys.Res.Commun_380_419
PubMedID: 19250629
Gene_locus related to this paper: human-ABHD2 , mouse-ABHD2

Title : Elevated mature macrophage expression of human ABHD2 gene in vulnerable plaque - Miyata_2008_Biochem.Biophys.Res.Commun_365_207
Author(s) : Miyata K , Nakayama M , Mizuta S , Hokimoto S , Sugamura K , Oshima S , Oike Y , Sugiyama S , Ogawa H , Yamamura K
Ref : Biochemical & Biophysical Research Communications , 365 :207 , 2008
Abstract : Miyata_2008_Biochem.Biophys.Res.Commun_365_207
ESTHER : Miyata_2008_Biochem.Biophys.Res.Commun_365_207
PubMedSearch : Miyata_2008_Biochem.Biophys.Res.Commun_365_207
PubMedID: 17980156
Gene_locus related to this paper: human-ABHD2 , mouse-ABHD2

Title : Increase of smooth muscle cell migration and of intimal hyperplasia in mice lacking the alpha\/beta hydrolase domain containing 2 gene - Miyata_2005_Biochem.Biophys.Res.Commun_329_296
Author(s) : Miyata K , Oike Y , Hoshii T , Maekawa H , Ogawa H , Suda T , Araki K , Yamamura K
Ref : Biochemical & Biophysical Research Communications , 329 :296 , 2005
Abstract : Miyata_2005_Biochem.Biophys.Res.Commun_329_296
ESTHER : Miyata_2005_Biochem.Biophys.Res.Commun_329_296
PubMedSearch : Miyata_2005_Biochem.Biophys.Res.Commun_329_296
PubMedID: 15721306
Gene_locus related to this paper: human-ABHD2 , mouse-ABHD2

Title : Primary structure of a human protein which bears structural similarities to members of the rhodopsin\/beta-adrenergic receptor family -
Author(s) : Rapiejko PJ , George ST , Malbon CC
Ref : Nucleic Acids Research , 16 :8721 , 1988
PubMedID: 2843827
Gene_locus related to this paper: human-ABHD2