arath-HNL

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) HNL F18D22_70 at5g10300 alpha-hydroxynitrile lyase-like

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
9 structures (e.g. : 6COB, 6COC, 6COD... more)
No kinetic

Substrate: Cyanide-ion ,

2 Genbank : AL360334, GL348718
2 UniProt : Q9LFT6, D7M2V7
1 Ncbi-nid : 8953404
1 Ncbi-pid : 8953411
>3 Structure links 6 more: 6COB, 6COC, 6COD
2 UniProtTrembl : Q9LFT6, D7M2V7
2 Interpro : Q9LFT6, D7M2V7
2 Prodom : Q9LFT6, D7M2V7
2 Pfam : Q9LFT6, D7M2V7
2 PIRSF : Q9LFT6, D7M2V7
2 SUPERFAM : Q9LFT6, D7M2V7
2 QuickSwissBlast : Q9LFT6, D7M2V7
1 Tair database : At5g10300
 
Sequence
Graphical view for this peptide sequence: arath-HNL
Colored MSA for Hydroxynitrile_lyase (raw)
MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQ
AVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKV
LVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMG
PKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQR
VYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSL
SAIATDYM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQ
AVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKV
LVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMG
PKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQR
VYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSL
SAIATDYM

Graphical view for this nucleotide DNA sequence (1073 bp): arath-HNL



References
1 more
    Title: Hydroxynitrile lyases with alpha/beta-hydrolase fold: two enzymes with almost identical 3D structures but opposite enantioselectivities and different reaction mechanisms
    Andexer JN, Staunig N, Eggert T, Kratky C, Pohl M, Gruber K
    Ref: Chembiochem, 13:1932, 2012 : PubMed

            

    Title: An R-selective hydroxynitrile lyase from Arabidopsis thaliana with an alpha/beta-hydrolase fold
    Andexer J, von Langermann J, Mell A, Bocola M, Kragl U, Eggert T, Pohl M
    Ref: Angew Chem Int Ed Engl, 46:8679, 2007 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
    Asamizu E, Sato S, Kaneko T, Nakamura Y, Kotani H, Miyajima N, Tabata S
    Ref: DNA Research, 5:379, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer