Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-SCP28

Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), SCP28 At2g35770, putative serine carboxypeptidase II

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AC007017
2 UniProt : Q8S8K6, D7LIK5
2 UniProt : Q8S8K6, D7LIK5
2 Interpro : Q8S8K6, D7LIK5
2 Prodom : Q8S8K6, D7LIK5
2 Pfam : Q8S8K6, D7LIK5
2 PIRSF : Q8S8K6, D7LIK5
2 SUPERFAM : Q8S8K6, D7LIK5
1 Tair database : At2g35770
Sequence
Graphical view for this peptide sequence: arath-SCP28
Colored MSA for Carboxypeptidase_S10 (raw)
MVIALLDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGR
ALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKT
LRLNLYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFL
VRWLERFPEYKERAFYIAGESYAGHYIPELAQLIVNRNKGAKNPTINLKG
ILMGNPLVDDYNDNKGMRDYWWNHGLISDESYNDLTKWCLNDSILFPKLN
CNAALNQALSEFGDIDPYNINSPACTTHASSNEWMQAWRYRGNDECVVGY
TRKYMNDPNVHKSFHARLNGSTPWTPCSRVIRKNWKDSPKSMLPIIKNLL
QAHLRIWIFSGDSDAVLPLSGTRHSINAMKLKSSKRWYPWYHSHGLVGGW
SQVYEDGLLTYTTVRAAGHEVPLSQPRLALFLFTHFLANHSLPSSPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVIALLDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGR
ALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKT
LRLNLYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFL
VRWLERFPEYKERAFYIAGESYAGHYIPELAQLIVNRNKGAKNPTINLKG
ILMGNPLVDDYNDNKGMRDYWWNHGLISDESYNDLTKWCLNDSILFPKLN
CNAALNQALSEFGDIDPYNINSPACTTHASSNEWMQAWRYRGNDECVVGY
TRKYMNDPNVHKSFHARLNGSTPWTPCSRVIRKNWKDSPKSMLPIIKNLL
QAHLRIWIFSGDSDAVLPLSGTRHSINAMKLKSSKRWYPWYHSHGLVGGW
SQVYEDGLLTYTTVRAAGHEVPLSQPRLALFLFTHFLANHSLPSSPS


References
1 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Whole genome sequence comparisons and full-length cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation
    Castelli V, Aury JM, Jaillon O, Wincker P, Clepet C, Menard M, Cruaud C, Quetier F, Scarpelli C and Salanoubat M <4 more author(s)>
    Ref: Genome Res, 14:406, 2004 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer