arath-T26B15.8

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At2g32520 t26b15.8 putative carboxymethylenebutenolidaseprotein

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AC004681, AY086081
3 UniProt : Q8LDC7, D7LEZ5, O80889
3 UniProtTrembl : O80889, Q8LDC7, D7LEZ5
3 Interpro : O80889, Q8LDC7, D7LEZ5
3 Prodom : O80889, Q8LDC7, D7LEZ5
3 Pfam : O80889, Q8LDC7, D7LEZ5
3 PIRSF : O80889, Q8LDC7, D7LEZ5
3 SUPERFAM : O80889, Q8LDC7, D7LEZ5
3 QuickSwissBlast : O80889, Q8LDC7, D7LEZ5
1 Tair database : At2g32520
 
Sequence
Graphical view for this peptide sequence: arath-T26B15.8
Colored MSA for Dienelactone_hydrolase (raw)
MADSAFRKIQIQRDDTTFDAYVVGKDDAPGIVVIQEWWGVDFEIKNHAIK
ISQLEPGFKALIPDLYRGKVGLDTAEAQHLMDGLDWPGAIKDIRASVNWL
KSNGSKKVGVTGMCMGGALAIASSVLVPEVDAVVGFYGTPSSELADPAQA
KAPIQAHFGELDNFVGFSDVTAAKNLEEKLKASGVAHEVHIYPGNGHAFL
NRSPEGVSRRKSMGLSDEDEAAVELAWSRFTSWMKQYLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADSAFRKIQIQRDDTTFDAYVVGKDDAPGIVVIQEWWGVDFEIKNHAIK
ISQLEPGFKALIPDLYRGKVGLDTAEAQHLMDGLDWPGAIKDIRASVNWL
KSNGSKKVGVTGMCMGGALAIASSVLVPEVDAVVGFYGTPSSELADPAQA
KAPIQAHFGELDNFVGFSDVTAAKNLEEKLKASGVAHEVHIYPGNGHAFL
NRSPEGVSRRKSMGLSDEDEAAVELAWSRFTSWMKQYLA

no DNA




References
1 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Features of Arabidopsis genes and genome discovered using full-length cDNAs
    Alexandrov NN, Troukhan ME, Brover VV, Tatarinova T, Flavell RB, Feldmann KA
    Ref: Plant Mol Biol, 60:69, 2006 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer