Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA3703

Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, phospholipase/carboxylesterase family protein

Comment
previously 5_AlphaBeta_hydrolase Bacillus cereus (G9241; AH1271; ATCC 10876; 95/8201; m1293; 172560W; Q1; ATCC 4342; Rock1-15; NVH0597-99; AH820; G9842; m1550; BDRD-ST26; Rock3-42; AH1134; F65185; Rock4-2; MM3; AH187); var. anthracis CI); B4264; W; H3081.97; BDRD-ST24), Bacillus thuringiensis (BMB171; IBL 4222; IBL 200; Bt407; serovars: israelensis ATCC 35646, monterrey BGSC 4AJ1, chinensis CT-43, thuringiensis str. T01001, pulsiensis BGSC 4CC1, sotto str. T04001, pondicheriensis BGSC 4BA1, andalousiensis BGSC 4AW1, tochigiensis BGSC 4Y1, berliner ATCC 10792, kurstaki T03a001, pakistani T13001, huazhongensis BGSC 4BD1; subsp. konkukian), Bacillus anthracis ( Ames; A0488; CDC 684 / NRRL 3495; A0193; A0174; A0248; A0389; Tsiankovskii-I; A0442; A0465)


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AE017355, AE017035, AAEK01000022
>3 UniProt links 21 more: Q6HFG0, Q3EJB9, C2YUV4
>3 UniProt links 21 more: Q81Y54, Q6HFG0, Q3EJB9
>3 Interpro links 21 more: Q81Y54, Q6HFG0, Q3EJB9
>3 Prodom links 21 more: Q81Y54, Q6HFG0, Q3EJB9
>3 Pfam links 21 more: Q81Y54, Q6HFG0, Q3EJB9
>3 PIRSF links 21 more: Q81Y54, Q6HFG0, Q3EJB9
>3 SUPERFAM links 21 more: Q81Y54, Q6HFG0, Q3EJB9
Sequence
Graphical view for this peptide sequence: bacan-BA3703
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIMDPEASVLSVRGNV
LENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDGAAKTYEFDRNNIVAI
GYSNGANIAASLLFHYDNALKGAVLHHPMVPRRGTQLPNLAGKSVFIAAG
TNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYEN
TVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIMDPEASVLSVRGNV
LENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDGAAKTYEFDRNNIVAI
GYSNGANIAASLLFHYDNALKGAVLHHPMVPRRGTQLPNLAGKSVFIAAG
TNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYEN
TVL


References
4 more
    Title: Genomic characterization of the Bacillus cereus sensu lato species: backdrop to the evolution of Bacillus anthracis
    Zwick ME, Joseph SJ, Didelot X, Chen PE, Bishop-Lilly KA, Stewart AC, Willner K, Nolan N, Lentz S and Read TD <4 more author(s)>
    Ref: Genome Res, 22:1512, 2012 : PubMed

            

    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer