Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brume-BMEI1822

Brucella melitensis, B. suis, B. abortus, B. ovis, B. sp., B. pinnipedialis, B. ceti B. neotomae, B. microti s-formylglutathione hydrolase (EC 3.1.2.12)

Comment
Other strains: Brucella melitensis (strains bv. 3 str. Ether; bv. 1 str. Rev.1; bv. 1 str. 16M; bv. 2 str. 63/9) Brucella suis (and strains bv. 3 str. 686; bv. 5 str. 513; bv. 4 str. 40) Brucella abortus (and strains 2308; bv. 3 str. Tulya; bv. 2 str. 86/8/59; bv. 9 str. C68; NCTC 8038; bv. 4 str. 292; 2308; S19) Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512; bv. 6 str. 870) Brucella sp. (strains 83/13; F5/99) Brucella canis (strain ATCC 23365 / NCTC 10854) Brucella pinnipedialis (M292/94/1; B2/94; M163/99/10) Brucella ceti (strains Cudo; M13/05/1; M644/93/1; M490/95/1; B1/94) Brucella neotomae (5K33) Brucella microti (strain CCM 4915)


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Brucella melitensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella melitensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brume-BMEI1822
Colored MSA for A85-EsteraseD-FGH (raw)
MGVRNFMETISTARCFDGTQGVYRHKSEACQCDMTFALFLPPQAKDGPVP
VLWYLSGLTCTHQNVMDKGEYRQLASELGIAVICPDTSPRGDSIADEPDN
WQFGKGAGFYVDAMQAPFAQNYRMYSYITQELSALVARQFPLDMERQAIT
GHSMGGHGALTIALKNPDRFKSVSAFAPIVQPSTAGWSRPALEKYLGPDE
QAWRAYDATLLIEDGHRFPEILVDQGTADGFLDDGLRPWLLEEACRKAGI
ALTLNMREGYDHSYFFISTFMGDHLRWHSERLRS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVRNFMETISTARCFDGTQGVYRHKSEACQCDMTFALFLPPQAKDGPVP
VLWYLSGLTCTHQNVMDKGEYRQLASELGIAVICPDTSPRGDSIADEPDN
WQFGKGAGFYVDAMQAPFAQNYRMYSYITQELSALVARQFPLDMERQAIT
GHSMGGHGALTIALKNPDRFKSVSAFAPIVQPSTAGWSRPALEKYLGPDE
QAWRAYDATLLIEDGHRFPEILVDQGTADGFLDDGLRPWLLEEACRKAGI
ALTLNMREGYDHSYFFISTFMGDHLRWHSERLRS


References
3 more
    Title: Completion of the genome sequence of Brucella abortus and comparison to the highly similar genomes of Brucella melitensis and Brucella suis
    Halling SM, Peterson-Burch BD, Bricker BJ, Zuerner RL, Qing Z, Li LL, Kapur V, Alt DP, Olsen SC
    Ref: Journal of Bacteriology, 187:2715, 2005 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer