Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plafa-MAL6P1.135

Plasmodium falciparum (isolate 3D7) PF3D7_0629300 Phosphatidylcholine-sterol acyltransferase, putative (EC 2.3.1.43)

Comment
long region of repeats non homologous in N-term


Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Plasmodium falciparum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Laverania): N E > Plasmodium falciparum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL844505, CR382401
1 UniProt : C6KTC8
1 UniProt : C6KTC8
1 Interpro : C6KTC8
1 Prodom : C6KTC8
1 Pfam : C6KTC8
1 PIRSF : C6KTC8
1 SUPERFAM : C6KTC8
Sequence
Graphical view for this peptide sequence: plafa-MAL6P1.135
Colored MSA for PC-sterol_acyltransferase (raw)
KPTTYLLPGLGGSTLIAEYKNATIHSCSRYLLNSKPFRIWISLSRLLSIQ
SNIYCTFDTIRLKYDEKKNIYYNQPGVFIDVEKFGNLKGIEYLDYFNNTG
IGITKYFNVVGQYFTSHGYVDGESIIGAPYDWRYPLSQQNYKILKEHIEY
IYEKRNGTKVNLIGHSLGGLYLNFFLSRVVSKKWKQKHLSKIIFISTPFK
GSVKTIRALIQSRKDFISFRITKLIKLSIPESMMKALGNSLGSLFDILPY
REYYKRDQVVILINMSNTPIDEDHVQYLVTLCGIYKPECYRNRADVNLKV
YTLKNWHELLDDKLKAKYENYKLYRERYYNKDHGVPIYCLYSTINKKETE
YLLYFETQNTREEPTIYYGTGDGTVGTESLQACSNFYNTVLTHHFSDTSH
VGILYTNETAKYIYDIVESPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KPTTYLLPGLGGSTLIAEYKNATIHSCSRYLLNSKPFRIWISLSRLLSIQ
SNIYCTFDTIRLKYDEKKNIYYNQPGVFIDVEKFGNLKGIEYLDYFNNTG
IGITKYFNVVGQYFTSHGYVDGESIIGAPYDWRYPLSQQNYKILKEHIEY
IYEKRNGTKVNLIGHSLGGLYLNFFLSRVVSKKWKQKHLSKIIFISTPFK
GSVKTIRALIQSRKDFISFRITKLIKLSIPESMMKALGNSLGSLFDILPY
REYYKRDQVVILINMSNTPIDEDHVQYLVTLCGIYKPECYRNRADVNLKV
YTLKNWHELLDDKLKAKYENYKLYRERYYNKDHGVPIYCLYSTINKKETE
YLLYFETQNTREEPTIYYGTGDGTVGTESLQACSNFYNTVLTHHFSDTSH
VGILYTNETAKYIYDIVESPN


References
    Title: Functional annotation of serine hydrolases in the asexual erythrocytic stage of Plasmodium falciparum
    Elahi R, Ray WK, Dapper C, Dalal S, Helm RF, Klemba M
    Ref: Sci Rep, 9:17532, 2019 : PubMed

            

    Title: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13
    Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R and Barrell BG <70 more author(s)>
    Ref: Nature, 419:527, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer