Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-PA3859

Pseudomonas aeruginosa probable carboxylesterase

Comment
Other strains: Pseudomonas aeruginosa (UCBPP-PA14; LESB58; C3719; 2192; 39016; ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 Genbank : AE004803
1 UniProt : Q9HXE7
2 Structure : 3CN7, 3CN9
1 UniProt : Q9HXE7
1 Interpro : Q9HXE7
1 Prodom : Q9HXE7
1 Pfam : Q9HXE7
1 PIRSF : Q9HXE7
1 SUPERFAM : Q9HXE7
Sequence
Graphical view for this peptide sequence: pseae-PA3859
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MSEPLILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQA
PSQAVTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAK
GIAAERIILAGFSQGGAVVLHTAFRRYAQPLGGVLALSTYAPTFDDLALD
ERHKRIPVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDYPMGHEVS
LEEIHDIGAWLRKRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEPLILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQA
PSQAVTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAK
GIAAERIILAGFSQGGAVVLHTAFRRYAQPLGGVLALSTYAPTFDDLALD
ERHKRIPVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDYPMGHEVS
LEEIHDIGAWLRKRL


References
5 more
    Title: Isolation, characterization, and heterologous expression of a carboxylesterase of Pseudomonas aeruginosa PAO1
    Pesaresi A, Devescovi G, Lamba D, Venturi V, Degrassi G
    Ref: Curr Microbiol, 50:102, 2005 : PubMed

            

    Title: Crystallization, X-ray diffraction analysis and phasing of carboxylesterase PA3859 from Pseudomonas aeruginosa
    Pesaresi A, Lamba D
    Ref: Biochimica & Biophysica Acta, 1752:197, 2005 : PubMed

            

    Title: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen
    Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ and Olson MV <21 more author(s)>
    Ref: Nature, 406:959, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer