Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sphpi-linb

Sphingomonas paucimobilis (Pseudomonas paucimobilis); Sphingomonas sp., Sphingobium (japonicum ummariense indicum), Pseudomonas aeruginosa, LinB

Comment
Other strains: Sphingomonas paucimobilis (Pseudomonas paucimobilis) Sphingobium japonicum (strain NBRC 101211 / UT26S); Pseudomonas aeruginosa, Sphingomonas sp. (MM-1; SS04-3; HZ-1; P21; P8; P1; P12; BHC-A; P7; NM05) Sphingobium sp. (NM05; MI1205; SS04-4; SS04-1; SS04-5; HDIP04); Plasmid pLB1 1,4-TCDN; Sphingobium japonicum; Sphingobium ummariense RL-3, Sphingobium indicum B90A, uncultured bacterium, Xanthomonas sp. ICH12 (P51698 LINB_SPHPI obsolete entry)


Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Sphingomonas paucimobilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingomonas: N E > Sphingomonas paucimobilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
17 structures (e.g. : 1CV2, 1D07, 1G42... more)
No kinetic





32 substrates (e.g. : (Bromomethyl)cylcohexane, 1,2,3-Tribromopropane, 1,2-Dibromo-3-Chloropropane... more)
No inhibitor
>3 Genbank links 31 more: D14594, DQ767899, AP010803
>3 UniProt links 25 more: D4Z2G1, Q0PV40, Q5EDI0
1 Ncbi-nid : 4521185
1 Ncbi-pid : 4521186
>3 Structure links 14 more: 1CV2, 1D07, 7NFZ
>3 UniProt links 25 more: D4Z2G1, A0A1L5BTC1, Q0PV40
>3 Interpro links 25 more: D4Z2G1, A0A1L5BTC1, Q0PV40
>3 Pfam links 25 more: D4Z2G1, A0A1L5BTC1, Q0PV40
>3 PIRSF links 25 more: D4Z2G1, A0A1L5BTC1, Q0PV40
>3 SUPERFAM links 25 more: D4Z2G1, A0A1L5BTC1, Q0PV40
Sequence
Graphical view for this peptide sequence: sphpi-linb
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMP
HCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGD
RVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDL
FQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEA
RRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTT
GRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMP
HCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGD
RVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDL
FQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEA
RRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTT
GRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA


References
31 more
    Title: Transformation of short-chain chlorinated paraffins and olefins with the bacterial dehalogenase LinB from Sphingobium Indicum - Kinetic models for the homologue-specific conversion of reactive and persistent material
    Knobloch MC, Schinkel L, Kohler HE, Mathis F, Kern S, Bleiner D, Heeb NV
    Ref: Chemosphere, 283:131199, 2021 : PubMed

            

    Title: Substrate inhibition by the blockage of product release and its control by tunnel engineering
    Kokkonen P, Beier A, Mazurenko S, Damborsky J, Bednar D, Prokop Z
    Ref: RSC Chemical Biology, 2:645, 2021 : PubMed

            

    Title: Differences in crystallization of two LinB variants from Sphingobium japonicum UT26
    Degtjarik O, Chaloupkova R, Rezacova P, Kuty M, Damborsky J, Kuta Smatanova I
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 69:284, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer