horvd-f2d241

Hordeum vulgare var. distichum (Domesticated barley). Predicted protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAPGTTEPLLLRPEQRRRPRDWFAWGLPAAVLLLLLLSVS
GPLRPPLFRV PAPETVPLTLLAGAQEKGAVCLDGTPPGY
HLQRGSGDGSNRWLIHLEGGG WCSTVKDCSNRRMYALGS
SNFMKPMRFAGAGILGSDQLQNPDFYNWNKVF VRYCDGA
SFSGDAEGRAQDGSILYFRGLRIYQAVLDELMEKGLANAT
QAL LTGCSAGGLATILHCDDFSARFSRDVSVKCLADAGF
FLDVKDISGKRSFW SVYDGVVHLQNVREVLPKDCLANKE
PTECFFPAELIKSTRTPMFILNSAY DSWQVRNVLVPVSS
APDKSWSSCKDNIRNCNSTQIKVLNGFRNTMVGALN VVE
DKEDWGLFIDSCFTHCQSLYGISWNSEISPRLGNKTIAEA
AGDWYHG RSRRVKEIDCEYPCNPTCSGQLPP

References