horvd-f2djx2

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : Hydroxynitrile_lyase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPLSLCRTSCVNIGATSARKSSHKTRRMRMEAPADQASGK
HIVLVHGACI GGWAWFKVATRLRDAGHRVSTPDLAASGV
DPRPLCEVPTFFDYTKPLLDL LDSLPPGEKVVLVGHSLG
GVNIALACELFPEKVAAAVFLSAFMPDHRSPP SYVLEKF
VEGGTLDWMDTEFKPQDPEGKLPTAMQFGPLVTRAKFLQL
CSP EDLTLARSLMRVSSMFVEDLRLQPPYTEARYGSVRK
VFIVLKDDNAIVEG FQRWMVQNYPVDEVKEIDGADHMAL
FSTPAELAHCLSDIAVKYAP

References