horvd-f2cvb1

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : Maspardin-ACP33-SPG21_like

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTALGGGAASPGDYIYFKSVVPLHKISIGSKLWRYYDFGP
KVVPPLICIP GIAGTADVYYKQIMSLSMKGYRVISIDVP
QVWNHHEWIHSFEKFLDSMNI HHVHICGTSLGGFLAQIF
AQYRPRRVKSLVLSNTFLETHKFAAAMPWSPL VSWTPSF
LLKRYLLTGIRDGPHEPFIADSVDFVVGQVETLSREDLSS
RLI LNVNVASVGSLSLPDSFVTIMDTSDYSAVPQQLKDQ
VNERYPSAKRAVLR TGGDFPFLSRPDEVNLYLQLHLRRV
GVEPRPDLVQGFTRGGSSGSSNDHE DGNSFDDHTRDDGH
RSSGRDGRKTERSESGPPNSDGLVPTSIVLGMVSSA LHV
SVCVCS

References