horvd-f2cu28

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : LYsophospholipase_carboxylesterase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

GFVALASVVASRRGGTAAAATVRGMSFGGASSVAAGAKRP
FEYGRTHVVR PKGAHKATIVWLHGLGDNGASWSQLLETL
PLPNIKWICPTAPTRPVAIFG GFPSTAWFDVADLSEDSP
DDVEGLDSSAAHVANLLSTEPADIKLGVGGFS MGAATAL
YSGTCFAHGKYGNGNPYPVNLSVAVGLSGWLPCARSLKNK
IES SQEAAQKASSLPLMLCHGKADDVVLYKHGERSADAL
KSTGFANVEFKSYS RLGHYTVPEEMDEVVKWLTASLELG
SSSST

References