horvd-f2d8w8

Hordeum vulgare var. distichum (Two-rowed barley) Lipase

Comment

Relationship

Family : Acidic_Lipase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAVPGGGAAAAALALTLLLRYCVPGGAYGSPASSTLRHAV
PRGDAGGGLC GQLLLPLGYPCTEHTVETNDGFLLSLQHI
PHGKNGVADNTGPPVFLQHGL FQGGDTWFINSAEQSLGY
ILADNGFDVWIGNVRGTRWSKGHSTFTVHDKL FWDWSWQ
ELAEYDLLAMLSYVYTVRQSKILYVGHSQGTIMGLAAFTL
PEI TKMISAAALLCPISYLDHVSASFVLRAVGMHLDQML
LTMGFHQLNFRSAM GVQIVDSICDDGHVDCNDLLSSITG
ENCCFNGSRIDHYLEYEPHPSSTKN LHHLFQMIRKGTFA
RYDYGLWGNLRRYGGLSPPPFDLSSIPESLPMWMGY GGL
DELADVTDVARTIKELRSTPELLYIAGYGHIDFVMSVKAK
DDVYVDM MRFLRLRAKGSLHSSY

References