horvd-f2dnr0

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : abh_upf0017

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAAIQAPSPFAGTARRYAPRLRYLLLPTTMSLSSSVVSSR
SRDRDCADGE QPLLPHSSLEIAGARRGLLAGFESLRRPY
RAFPVFASNRHVETIFAAFTR SLPAVAFRRECLRTPDDG
AVALDWVSGDDRTLPGDAPVLILLPGLTGGSQ DTYVRHM
LLRARSKGWRVVVFNSRGCANSPVTTAKFYSASFTGDLRQ
VVD HVLSRYPQSNIYAAGWSLGANILVRYLGEETDKCSL
SGAVSMCNPFNLVI ADEDFYKGFNNVYDRALANSLGAIF
KKHALLFEGLDGEYDIPKAANAKTV RDFDEGLTRVSFGF
RSVDDYYSNSSSSDSIKNVSIPLLCIQADNDPIAPS RGI
PREDIKANPNCLLIVTPEGGHLGWVAGNEAPFGCPWTDPI
VMEFLEH VHNETGSTTKNTVFSEPQGVPQTSVPHLSEHV

References