horvd-f2dam1

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

"only c-term Pfam A Peptidase_S28 81 506"

Relationship

Family : Prolylcarboxypeptidase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

SRFTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKP
AAGPLFVYTG NEGDIEWFATNTGFLFDIAPDFGALLVFI
EHRFYGESKPFGNDSYKSADT LGYLTSTQALADFAVLIT
SLKHNLSTVDAPVVVFGGSYGGMLASWFRLKY PHVAMGA
VASSAPILQFDDITPWSSFYDTVSQDFKSESLNCFSVIKA
AWD VLDDRGSNHTGLLELSKTFRACKTVKSADSLGDWLS
TAFTYTAMVDYPTP ANFMMNLPAYPVKEMCKIIDSFPTG
ADIIDKAFAAASLYYNYTGDQKCFQ VEGDDDPHGLDGWD
WQACTEMVMPMIVSNESMFPPSSFSYENNSDACLAD YGV
RPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRG
GVLKNIS SSIIALVTEKGAHHLDFRSETKDDPDWVVEQR
RQEVEIIHGWIDQYNKDI AQM

References