horvd-f2djs2

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : Prolylcarboxypeptidase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVSRAGLASLLGASFLLLLARSAEPLGFSHRPRTAGGELS
AAPSRYLARE ERWMSQRLDHFSSSDHRQFKQRYFEFLDY
HDDPTGPVFLRICGESSCDGI PNDYLAVIAKKFGAAVVT
PEHRYYGKSSPFDSLTTDNLRFLSSKQALFDL AVFRQYY
QEKLNSRYNRSAGFDNPWFVFGVSYSGALSAWFRLKFPHL
TCG SLASSGVVLAVYNFTDFDKQVGDSAGPECKAALQEI
TRLVDKQLLSDSHS VKALFGADSLKNDGDFLFLLADAAA
TTFQYGNPDALCSPLANAKKKGESL VETYAHFVKDYYIK
KLGTTVSSYDQEYLKETTPDDSSSRLWWFQVCSEVA YFQ
VAPKNDSVRSAQIDTRYNLDLCKNVYGEGVYPDVFMTNLY
YGGTSIA ASKIVFTNGSQDPWRHASKQKSSEGMPSYIIK
CSNCGHGTDLRGCPQLPF RIEGDSSNCTSPEAVNTVRKQ
IVKHIDLWLSQCHEPARAW

References