horvd-f2d4p5

Hordeum vulgare var. distichum (Domesticated barley). Predicted protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGEKMRMTKLWALPLVVLVLGASAPSVPAVPITILTSAVA
KGAVCMDGTP PAYHMDPGSGAGKKSWIVNLEGGGWCESV
MACMYRKGSRLGSSNLMERQL EFRGILSSNPAENPDFYS
WNRVMVRYCDGASFTGEGYNAGSKVYFRGQRI WNAVMQH
LLSIGMSSADQVLLAGGSAGGLSAILHCDQFGTFFAGRST
TVK CLADAGLFLDAVDISGGRTLRSYFGGIVATHGVAQN
LPRSCTGHLDATSC FFPQNIIGSINTPIFLLNAAYDTWQ
IHESLAPDVADHNGTWRACKSNRLA CNASQMKVLQAFRD
QMVGIVQGLSRSKSYGLFINSCFTHGQSKVPATWNA NGS
PTIHNKSIAKSVSDWYFGRAEVRAIDCPYPCDHTCHHDM

References