horvd-f2de38

Hordeum vulgare var. distichum (Two-rowed barley) Protein phosphatase methylesterase 1

Comment

Relationship

Family : PPase_methylesterase_euk

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEPAPLSSLQEEGGPDESSSSSAFSAAAVPPRPATHHSLQ
KYAPVDWSAY FDEERPVAIPDTEDVFNVYMAGSEGPVVF
CLHGGGYSGLSFALAANQIKG KARVVAMDLRGHGKSSTS
DDLDLSIETLTNDVIVVIRALYGDLPPAIILV GHSMGGS
VAVHVAARRAIHNLHGLVVVDVVEGTAIASLIHMQKILLN
RAQ HFPSIEKAIEWSVKGGPLRNIDSARVSIPSTLKYDE
SKECYTYRTPLEKT EKYWKGWYEGLSDKFLSCPVQKILL
LAGTDRLDRSLTIGQMQGKFQMIVV RHTGHAIQEDVPEE
FASHILNFISRNKIGPNGVEIPGLIKKWQH

References