horvd-f2dnj9

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

TPTMPHVNAKVSAVAATGMAAVPAAAAPPPPPPRRWEGVD
PALERMVLRA CLDQAPERRRVREAFKDVQLSIDHCLFKA
QYSDIGTKESYERNSRGVEIF SKCWFPENHRMKAIVCLC
HGYGDTCTFFLDGIARKIASAGYGVFALDYPG FGLSEGL
HGYIPSFDTLVDDVAEHFAKIKGNPEYRELPSFLFGQSMG
GAV ALKIHFKQPKEWNGAILVAPMCKISDDVVPAWPVQQ
VLIFLAKLLPKEKL VPNKDLAELAFKEKEKQEQCSYNVI
AYKDKPRLRTALEMLRTTQEIESRL DEVSLPIIILHGDA
DLVTDPGVSKDLYEKAKTSDKMLCLYKDAYHAILEG EPD
EGIFKVLDDIISWLDQHSAKEIPSS

References