horvd-f2db20

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

"only Pfam A Abhydro_lipase 290 345"

Relationship

Family : Acidic_Lipase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

PVPTERKTVYRHALNTDSRTCEDVITELGYPYEAIKVVTS
DGYVLLLERI PRRDSRKVVLLQHGVLDSSMGWVSNGVVG
SPAFAAYDQGYDVFLGNLRGL VSREHMDKNLSSSKYWKY
SVNEHGTKDMPAIIEEIHKIKTSELGKSQNVI GEEREDK
NEDIQNSEIQTSEEDVTESQPYKLCAVCHSLGGAVMLMYV
VTS RIAQKPHRLSRLVLLSPAGFHEDSNVVFSMVEKIIL
FVGPVLAPLVPGLY IPTRFFRMLLNKLARDFHNYPALGG
LVQTLMGYIVGGDSSNWVGVLGLPH YNMDDMPGVSFHVV
LHLAQIKRAKRFQMYDYGSATANMEAYGTPKPLDLG AHY
NLIDIPMDLVAGQRDKVISPTMVKKHYKLMRKAGVEVSYN
EFEYAHL DFTFSHREELLSYVMSRLVLAADTGKGRIKQT
TVRLRRPKKIQLNIEK

References