horvd-f2d2e7

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : Prolylcarboxypeptidase

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

DHRQFKQRYYEFLDYHRAPNGPVFLNICGEASCSGISNNY
LAVMAKKFGA ALVSPEHRYYGKSSPFEDLTTENLRFLSS
KQALSDLAVFRQYYQETLNAK YNRSGADNSWFVFGGSYS
GALSAWFRLKFPHLTCGSLASSGVVLAVYNFT DFDRQIG
ESAGPECKAALQEITRLVDGQLQSGNNSVKELFGAKMLEN
DGD FLYLLADAAAIAFQYGNPDVLCSPLVEAKKNGTDLV
EAFAHYVNSYYVGR FKASVASYDQKYLKNTTPAESSYRL
WWYQVCSEVSYFQVAPKNDSVRSTK IDTRYHLDLCKNVF
GEGVYPDVSMTNLYYGGTRIAGSKIVFANGSQDPWR HAS
KQKSSEELPSYLIECSNCGHCTDISGCPQAPSNIEGDSSK
CSSPEAV NKVRKQIVDHIDLWLSECQDQ

References