horvd-f2djb2

Hordeum vulgare var. distichum (Domesticated barley). Predicted protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAPSNVPEALLRLLLLAASGLLGPMLSGAAPVEPVEVSLL
VGAQEKGAVC LDGTPPGYHLQRGSGDGSGSWLIHLEGGG
WCSTLKDCSGRRMSVLGSSNF MKPLQFAGHGIFDSDEIY
NPDFYNWNKVYVRYCDGASFAGDAEGQAQDGT TVYFRGL
RIYEAITDELMRKGLVNATQVLFTGCSAGGLATILHCDDF
SAR FPQQVSVKCFADAGFFLDVKDISGERSFWSLYNRVV
QLQNVRQVLHKDCL ANKEPTECFFPTEIIKSIRTPMFIL
NSAYDSWQIQNVLLPSSSSPEKSWL SCKDNIGNCNSTQI
KVLDEFRNTMINDLNIVEDKAGWGMFIDSCFTHCQT LFR
ISWNSPTSPRLGNKNIAKVVGDWYFGRSQGVKEIDCQYPC
NPTCNSL PPP

References