horvd-f2cu67

Hordeum vulgare var. distichum (Two-rowed barley) Predicted protein

Comment

Relationship

Family : S9N_PREPL_Peptidase_S9

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAAPPVARKVPRKLAEHGDVRVDDYYWLRDDARADPDVLA
HLRAENDYTA ALMSDTKQLEDEIFAEIRGRIKEDDVDVP
LRKGQYYYYKRTLTGKEYAQR CRRLVPTNGPITVHDEMP
TGPDAPAEHIILDENLKAEGHDYYSIGAFKVS PSGKLVA
YAEDTKGDEIYTVFVIDAESGQYVGQPLKAITSDIEWAGD
DNL VYITMDNILRPDKVWLHKLGCDQSDDTCLYHEKDDT
FSLGLHASESKQYL FVGSGSKNTSFIFYLDIPNQSKELA
VLTPRVDGIDTTASHRGNHFYITRR REEFYNSELVACPL
NNVTETTVLLPHRESVKIQDVQLFENHIAVYERENG LPK
ATVYRLPATGEAVGQLQGGRAIDFVDPAYAVEPEPSQFHS
NVIRFYY SSMRTPPSIFDYDMDTGVSVLKKIDTVLGGFE
VSNYVTERKWAAASDGTQ IPMSVLYRKDMVKLDGSDPML
LYGYGSYEICIDPTFRGSRFSLVDRGFIY VIAHIRGGGE
MGRNWYEDGKLMKKKNTFTDFIACAEHLIENKYCTKEKLC
INGRSAGGLLMGAVLNMRPDLFKAAVAGVPFVDVLTTML
DPTIPLTTAEW EEWGDPRKEEYYYYMKSYSPVDNVTAQD
YPHILVTAGLNDPRVMYSEPAK FVAKLRELKTDNNLLLF
KCELGAGHFSKSGRFEKLREDAFTYAFILKALG MTPPTA
ASSL

References