Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-PLA16

Arabidopsis thaliana (Mouse-ear cress) PLA16 T06B20.10 At2g30550 lipase isolog DAD1-Like Lipase 3, DALL3 PLA-Igamma2

Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U93215, NP_850148
2 UniProt : Q3EBR6, F4INU9
2 UniProt : F4INU9, Q3EBR6
2 Interpro : F4INU9, Q3EBR6
2 Pfam : F4INU9, Q3EBR6
2 PIRSF : F4INU9, Q3EBR6
2 SUPERFAM : F4INU9, Q3EBR6
1 Tair database : At2g30550
Sequence
Graphical view for this peptide sequence: arath-PLA16
Colored MSA for Plant_phospholipase (raw)
MTAEDIRRRDKKTEEERRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRY
GEMAQACYDAFDFDPASKYCGTSRFTRLEFFDSLGMIDSGYEVARYLYAT
SNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRNRLGRRDIAIAWR
GTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTDKDTTCKF
ARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIA
EMRLNRSKKGKVIPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDV
VPKSPGLFLNESRPHALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVD
VSTAHNLEAMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPP
FWRQDANKGMVRNSEGRWIQAERLRFEDHHSPDIHHHLSQLRLDHPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAEDIRRRDKKTEEERRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRY
GEMAQACYDAFDFDPASKYCGTSRFTRLEFFDSLGMIDSGYEVARYLYAT
SNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRNRLGRRDIAIAWR
GTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTDKDTTCKF
ARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIA
EMRLNRSKKGKVIPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDV
VPKSPGLFLNESRPHALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVD
VSTAHNLEAMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPP
FWRQDANKGMVRNSEGRWIQAERLRFEDHHSPDIHHHLSQLRLDHPC


References
6 more
    Title: Wound-induced expression of DEFECTIVE IN ANTHER DEHISCENCE1 and DAD1-like lipase genes is mediated by both CORONATINE INSENSITIVE1-dependent and independent pathways in Arabidopsis thaliana
    Rudus I, Terai H, Shimizu T, Kojima H, Hattori K, Nishimori Y, Tsukagoshi H, Kamiya Y, Seo M and Ishiguro S <2 more author(s)>
    Ref: Plant Cell Rep, 33:849, 2014 : PubMed

            

    Title: Cooperation and functional diversification of two closely related galactolipase genes for jasmonate biosynthesis
    Hyun Y, Choi S, Hwang HJ, Yu J, Nam SJ, Ko J, Park JY, Seo YS, Kim EY and Lee I <4 more author(s)>
    Ref: Dev Cell, 14:183, 2008 : PubMed

            

    Title: Phospholipid-derived signaling mediated by phospholipase A in plants
    Ryu SB
    Ref: Trends Plant Sci, 9:229, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer