arath-PLA16

 
Arabidopsis thaliana (Mouse-ear cress) PLA16 T06B20.10 At2g30550 lipase isolog DAD1-Like Lipase 3, DALL3

Relationship
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : U93215, NP_850148
2 UniProt : Q3EBR6, F4INU9
2 UniProtTrembl : F4INU9, Q3EBR6
2 Interpro : F4INU9, Q3EBR6
2 Prodom : F4INU9, Q3EBR6
2 Pfam : F4INU9, Q3EBR6
2 PIRSF : F4INU9, Q3EBR6
2 SUPERFAM : F4INU9, Q3EBR6
2 QuickSwissBlast : F4INU9, Q3EBR6
1 Tair database : At2g30550
 
Sequence
Graphical view for this peptide sequence: arath-PLA16
Colored MSA for Plant_phospholipase (raw)
MTAEDIRRRDKKTEEERRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRY
GEMAQACYDAFDFDPASKYCGTSRFTRLEFFDSLGMIDSGYEVARYLYAT
SNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRNRLGRRDIAIAWR
GTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTDKDTTCKF
ARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIA
EMRLNRSKKGKVIPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDV
VPKSPGLFLNESRPHALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVD
VSTAHNLEAMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPP
FWRQDANKGMVRNSEGRWIQAERLRFEDHHSPDIHHHLSQLRLDHPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAEDIRRRDKKTEEERRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRY
GEMAQACYDAFDFDPASKYCGTSRFTRLEFFDSLGMIDSGYEVARYLYAT
SNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRNRLGRRDIAIAWR
GTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTDKDTTCKF
ARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIA
EMRLNRSKKGKVIPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDV
VPKSPGLFLNESRPHALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVD
VSTAHNLEAMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPP
FWRQDANKGMVRNSEGRWIQAERLRFEDHHSPDIHHHLSQLRLDHPC

no DNA




References
4 more
    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer