arath-SCP8

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata(Lyre-leaved rock-cress) At2g22990 F21P24.5 SNG1 sinapoyltransferase (EC 2.3.1.92)

Comment
AT2G22990 replace F21P24.5 in MIPs called AtSMT


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AC004401, AF275313, AF361601
>3 UniProt links 3 more: Q8RUW5, Q3EBW0, A8MR78
1 Ncbi-nid : 13605550
1 Ncbi-pid : 13605551
>3 UniProtTrembl links 3 more: Q8RUW5, Q3EBW0, A8MR78
>3 Interpro links 3 more: Q8RUW5, Q3EBW0, A8MR78
>3 Prodom links 3 more: Q8RUW5, Q3EBW0, A8MR78
>3 Pfam links 3 more: Q8RUW5, Q3EBW0, A8MR78
>3 PIRSF links 3 more: Q8RUW5, Q3EBW0, A8MR78
>3 SUPERFAM links 3 more: Q8RUW5, Q3EBW0, A8MR78
>3 QuickSwissBlast links 3 more: Q8RUW5, Q3EBW0, A8MR78
1 Tair database : At2g22990
 
Sequence
Graphical view for this peptide sequence: arath-SCP8
Colored MSA for Carboxypeptidase_S10 (raw)
MSLKIKFLLLLVLYHHVDSASIVKFLPGFEGPLPFELETGYIGIGEDENV
QFFYYFIKSENNPKEDPLLIWLNGGPGCSCLGGIIFENGPVGLKFEVFNG
SAPSLFSTTYSWTKMANIIFLDQPVGSGFSYSKTPIDKTGDISEVKRTHE
FLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINL
QGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDP
SNTQCLKLTEEYHKCTAKINIHHILTPDCDVTNVTSPDCYYYPYHLIECW
ANDESVREALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRS
LIYSGDHDIAVPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNK
MTFATIKGGGHTAEYRPNETFIMFQRWISGQPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLKIKFLLLLVLYHHVDSASIVKFLPGFEGPLPFELETGYIGIGEDENV
QFFYYFIKSENNPKEDPLLIWLNGGPGCSCLGGIIFENGPVGLKFEVFNG
SAPSLFSTTYSWTKMANIIFLDQPVGSGFSYSKTPIDKTGDISEVKRTHE
FLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINL
QGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDP
SNTQCLKLTEEYHKCTAKINIHHILTPDCDVTNVTSPDCYYYPYHLIECW
ANDESVREALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRS
LIYSGDHDIAVPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNK
MTFATIKGGGHTAEYRPNETFIMFQRWISGQPL

Graphical view for this nucleotide DNA sequence (1590 bp): arath-SCP8



References
5 more
    Title: Structure determinants and substrate recognition of serine carboxypeptidase-like acyltransferases from plant secondary metabolism
    Stehle F, Brandt W, Milkowski C, Strack D
    Ref: FEBS Letters, 580:6366, 2006 : PubMed

            

    Title: Cloning of the SNG1 gene of Arabidopsis reveals a role for a serine carboxypeptidase-like protein as an acyltransferase in secondary metabolism
    Lehfeldt C, Shirley AM, Meyer K, Ruegger MO, Cusumano JC, Viitanen PV, Strack D, Chapple C
    Ref: Plant Cell, 12:1295, 2000 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer