Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-q9ffg7

Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein At5g44250; MLN1.18)

Relationship
Family|Duf_829
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AY054511, AY086741, BT008858
2 UniProt : Q9FFG7, A8MQK0
2 UniProt : Q9FFG7, A8MQK0
2 Interpro : Q9FFG7, A8MQK0
2 Prodom : Q9FFG7, A8MQK0
2 Pfam : Q9FFG7, A8MQK0
2 PIRSF : Q9FFG7, A8MQK0
2 SUPERFAM : Q9FFG7, A8MQK0
1 Tair database : At5g44250
Sequence
Graphical view for this peptide sequence: arath-q9ffg7
Colored MSA for Duf_829 (raw)
MWGIGGNYYWRKKNNNGGESEAIVVVFAWMSSEERNLKNHVDLYSSLLWD
SLVCHSQFLNMFLPDKAADLASNVVSELVKELKAKPVPLVFASFSGGPNA
CMYKVLQILEGTCETGLNPDDCRLVRNCISGFIYDSCPVDFTSDLGARLA
VHPTTLKMSSPPKPFVWAANGIASSLDYVFLNRFESQRAEYWQTLYSTII
MRVPYLILCSENDDLAPYQTIHNFATRLQELGGNVKLVKWNDSPHCGHYR
YNQVDYKAAVSEFLSKAASVYSQKTRSLDREAMKGTCHDEITEPIQSLGQ
STSGLNRSFNGTPLVTTDHFFVPSTVGYYVGRDGGYVQDEHKQDLICLSN
TQTNESVKPNGVLGQILFDVYIPKNVEDWDIKLSETGRSRRRPGKRFIRR
SRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWGIGGNYYWRKKNNNGGESEAIVVVFAWMSSEERNLKNHVDLYSSLLWD
SLVCHSQFLNMFLPDKAADLASNVVSELVKELKAKPVPLVFASFSGGPNA
CMYKVLQILEGTCETGLNPDDCRLVRNCISGFIYDSCPVDFTSDLGARLA
VHPTTLKMSSPPKPFVWAANGIASSLDYVFLNRFESQRAEYWQTLYSTII
MRVPYLILCSENDDLAPYQTIHNFATRLQELGGNVKLVKWNDSPHCGHYR
YNQVDYKAAVSEFLSKAASVYSQKTRSLDREAMKGTCHDEITEPIQSLGQ
STSGLNRSFNGTPLVTTDHFFVPSTVGYYVGRDGGYVQDEHKQDLICLSN
TQTNESVKPNGVLGQILFDVYIPKNVEDWDIKLSETGRSRRRPGKRFIRR
SRL


References
1 more
    Title: Features of Arabidopsis genes and genome discovered using full-length cDNAs
    Alexandrov NN, Troukhan ME, Brover VV, Tatarinova T, Flavell RB, Feldmann KA
    Ref: Plant Mol Biol, 60:69, 2006 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones
    Sato S, Kotani H, Nakamura Y, Kaneko T, Asamizu E, Fukami M, Miyajima N, Tabata S
    Ref: DNA Research, 4:215, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer