Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: asptc-a0a1l9nby7

Aspergillus tubingensis; Aspergillus kawachii (White koji mold) (Aspergillus awamori; Aspergillus niger. AB hydrolase-1 domain-containing protein

Comment
Other strains: Aspergillus tubingensis (strain CBS 134.48); Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus niger


Relationship
Family|MpaH
Block| X
Position in NCBI Life Tree|Aspergillus tubingensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus tubingensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: asptc-a0a1l9nby7
Colored MSA for MpaH (raw)
MSLSSNSSGPFRVVEHIVECQHIREYPAATANGQEDVLNLVVKQYIPLDN
PNPQPGDVTILAAHANGFPKELYEPLWEELYARSKANGFRIRSIWMADVA
HQGESSVVNEHLLGNDPSWFDHPRDLLHLINVKRKEMPRPIVGIGHSMGG
AHLAQLCLMHPRLIHSLVLLDPVIQRESTQLDGLEMAMRQRQRIAKTTQL
STYRRDTWPSRKAAAEAFKRNPFYLAWDSRVLDRWIEHGLRELPTAIYPL
DESQQKEGSGDRPVTLRTTLHQEVFTFSRPNYDGPPGKKVPVNKVTHPDL
NPDHLGSWPFYRPEPSRVFAMLPHLRPSVCYIFGGKSDMCLPEMMADKMA
ATGTGLGGSGGAPAGRVRDVYLAEFGHLLAQEAPKECADAAGKWLGAELE
RWRTEEREFQEQWSRKSKVEKVTIDSRWKEHVPRPERPKKNPAQSKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLSSNSSGPFRVVEHIVECQHIREYPAATANGQEDVLNLVVKQYIPLDN
PNPQPGDVTILAAHANGFPKELYEPLWEELYARSKANGFRIRSIWMADVA
HQGESSVVNEHLLGNDPSWFDHPRDLLHLINVKRKEMPRPIVGIGHSMGG
AHLAQLCLMHPRLIHSLVLLDPVIQRESTQLDGLEMAMRQRQRIAKTTQL
STYRRDTWPSRKAAAEAFKRNPFYLAWDSRVLDRWIEHGLRELPTAIYPL
DESQQKEGSGDRPVTLRTTLHQEVFTFSRPNYDGPPGKKVPVNKVTHPDL
NPDHLGSWPFYRPEPSRVFAMLPHLRPSVCYIFGGKSDMCLPEMMADKMA
ATGTGLGGSGGAPAGRVRDVYLAEFGHLLAQEAPKECADAAGKWLGAELE
RWRTEEREFQEQWSRKSKVEKVTIDSRWKEHVPRPERPKKNPAQSKL


References
    Title: Comparative genomics reveals high biological diversity and specific adaptations in the industrially and medically important fungal genus Aspergillus
    de Vries RP, Riley R, Wiebenga A, Aguilar-Osorio G, Amillis S, Uchima CA, Anderluh G, Asadollahi M, Askin M and Grigoriev IV <107 more author(s)>
    Ref: Genome Biol, 18:28, 2017 : PubMed

            

    Title: Draft Genome Sequence of Aspergillus niger Strain An76
    Gong W, Cheng Z, Zhang H, Liu L, Gao P, Wang L
    Ref: Genome Announc, 4:, 2016 : PubMed

            

    Title: Genome sequence of the white koji mold Aspergillus kawachii IFO 4308, used for brewing the Japanese distilled spirit shochu
    Futagami T, Mori K, Yamashita A, Wada S, Kajiwara Y, Takashita H, Omori T, Takegawa K, Tashiro K and Goto M <1 more author(s)>
    Ref: Eukaryot Cell, 10:1586, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer