bacsu-YRAK

 
Bacillus subtilis hypothetical protein yrak

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : X92868, U93875, Z99117
1 UniProtTrembl : O07937
1 Interpro : O07937
1 Prodom : O07937
1 Pfam : O07937
1 PIRSF : O07937
1 SUPERFAM : O07937
1 QuickSwissBlast : O07937
 
Sequence
Graphical view for this peptide sequence: bacsu-YRAK
Colored MSA for AlphaBeta_hydrolase (raw)
MTINNGTLQVPGANIHYQVRGSGPIILLVHGGGGDADKFHHVANHLANWY
TVVTYDRRGHSRSNLANQIEGYRVETHSDDAHRLLAKITNKPAYVFGSSS
GAVIGLDLCIRHPEQVHVMIPHEPILLQLLHGNELKQAEQFMEDLKKNHR
SEVIKLMSRLETDEQSKAVLTKRLLGNSTYFTEYEIQGILSYTLDFEALK
TVFTSSPMKILPAGGSASRELFPYRCANA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTINNGTLQVPGANIHYQVRGSGPIILLVHGGGGDADKFHHVANHLANWY
TVVTYDRRGHSRSNLANQIEGYRVETHSDDAHRLLAKITNKPAYVFGSSS
GAVIGLDLCIRHPEQVHVMIPHEPILLQLLHGNELKQAEQFMEDLKKNHR
SEVIKLMSRLETDEQSKAVLTKRLLGNSTYFTEYEIQGILSYTLDFEALK
TVFTSSPMKILPAGGSASRELFPYRCANA

no DNA




References
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: A 23911 bp region of the Bacillus subtilis genome comprising genes located upstream and downstream of the lev operon
    Parro V, San Roman M, Galindo I, Purnelle B, Bolotin A, Sorokin A, Mellado RP
    Ref: Microbiology, 143 ( Pt 4):1321, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer