bacsu-YTAP

5_AlphaBeta_hydrolase : bacsu-YITVBacillus subtilis hypothetical protein yitv.
6_AlphaBeta_hydrolase : bacsu-cbxnp Bacillus subtilis carboxylesterase NA ou NP naproxen ester hydrolase CesA P96688, bacsu-ybfk Bacillus subtilis ybkf CesB, bacsu-yqjlBacillus subtilis hypothetical protein yqjl, baciu-a0a0d5d3y1Bacillus subtilis. Uncharacterized protein.
A85-IroE-IroD-Fes-Yiel : bacsu-YJCHBacillus subtilis yjch (and subsp. natto BEST195) protein, bacsu-YUIIBacillus subtilis (and subsp. natto BEST195) YUII protein.
Acetyl-esterase_deacetylase : bacsu-CAH Bacillus subtilis cephalosporin c deacetylase (EC 3.1.1.41).
ACPH_Peptidase_S9 : bacsu-YTMABacillus subtilis putative peptidase, bacsu-yuxlBacillus subtilis probable peptidase yuxl (EC 3.4.21.-).
AlphaBeta_hydrolase : bacsu-YBDGBacillus subtilis ybdg protein, bacsu-ycgSBacillus subtilis gene ycgS, bacsu-yclEBacillus subtilis yclE BAA08999.1, bacsu-yqkdBacillus subtilis hypothetical protein yqkd, bacsu-YRAKBacillus subtilis hypothetical protein yrak, bacsu-YvaMBacillus subtilis gene yvaM RghR (rapG and rapH repressor).
Bacillus_lip : bacsu-yjauBacillus subtilis. hypothetical protein yjau.
CarbLipBact_1 : bacsu-YVAKBacillus subtilis, Bacillus amyloliquefaciens, Bacillus atrophaeus, Bacillus subtilis, YvaK protein Carboxylesterase.
Carbon-carbon_bond_hydrolase : bacsu-yugFBacillus subtilis gene yugF.
Carb_B_Bacteria : bacsu-pnbae Bacillus subtilis, Bacillus sp., EH84 para-nitrobenzyl esterase (pnbA) intracellular esterase B CarEW, bacsu-q4pns3Bacillus subtilis RRL-BB1. carboxylesterase, baciu-a0a0f0a5r4Bacillus subtilis; Bacillus licheniformis; Bacillus cereus. Carboxylic ester hydrolase.
Dienelactone_hydrolase : bacsu-yczhBacillus subtilis hypothetical 21.1 kda protein in sipu-kipi intergenic region.
Epoxide_hydrolase : bacsu-yfhMBacillus subtilis (and subsp. natto BEST195) yfhM Epoxide_hydrolase like Bsueh.
Haloperoxidase : bacsu-ydjpBacillus subtilis BAA22772.1 (and subsp. natto BEST195) peroxydase, bacsu-yisYBacillus subtilis (and subsp. natto BEST195) yisY Haloperoxidase like.
Hormone-sensitive_lipase_like : bacsu-brefe Bacillus subtilis brefeldin A esterase.
Hydrolase_RBBP9_YdeN : bacsu-YDEN Bacillus subtilis yden protein.
Lipase_2 : bacsu-lip Bacillus subtilis lipase (lipA) (EC 3.1.1.3) BSLA (triacylglycerol lipase), bacsu-LIPBBacillus subtilis, Bacillus sp., Bacillus megaterium, yfip (esterase) (EC 3.1.1.1) lipW estB lipA lipB lipJ.
LYsophospholipase_carboxylesterase : bacsu-MHQDBacillus subtilis yolf.
MenH_SHCHC : bacsu-ytxmBacillus subtilis, Bacillus sp. ytxm.
Monoglyceridelipase_lysophospholip : bacsu-YTPABacillus subtilis Bacilysocin biosynthesis protein ytpA.
Proline_iminopeptidase : bacsu-YBACBacillus subtilis, Bacillus sp. hypothetical 36.9 kda protein.
RsbQ-like : bacsu-yvfQ Bacillus subtilis yvfQ sigma factor sigb CAB08011.1 CAB15415.1 also regulation proteinRsbQ.
Thioesterase : bacsu-FENB Bacillus subtilis; Bacillus malacitensis; Bacillus [Brevibacterium] halotolerans fengycin synthetase, bacsu-ITUCBacillus subtilis; Bacillus amyloliquefaciens; Bacillus sp., Iturin a synthetase c, bacsu-MYCCBacillus subtilis mycc Mycosubtilin synthase subunit C Thioesterase domain, bacsu-PKSRBacillus subtilis polyketide synthase Thioesterase domain, bacsu-PPSEBacillus subtilis peptide synthetase orf5 Thioesterase domain, bacsu-q6yk39Bacillus subtilis Bacillus amyloliquefaciens; Bacillus velezensis; Mycobacterium abscessus; Bacillus sp., bacillomycin d synthetase c, bacsu-srf4 Bacillus subtilis csi16 Thioesterase domain, bacsu-srfac Bacillus subtilis surfactin synthetase subunit 3, bacsu-SRFCBacillus subtilis and Bacillus amyloliquefaciens putative surfactin synthetase (fragment), bacsu-SRFDBacillus subtilis, Bacillus sp. CY22, Bacillus amyloliquefaciens, srfD srfDB3 srfad putative thioesterase, bacsu-YUKLBacillus subtilis DHBF yukl protein yukk protein Thioesterase domain dimodular nonribosomal peptide synthetase

MRAERRKQLFRLLGDLPDRRPISVETLRIEEREENIVETLLLDLNGHEKA
PAYFVKPKKTEGPCPAVLFQHSHGGQYDRGKSELIEGADYLKTPSFSDEL
TSLGYGVLAIDHWGFGDRRGKAESEIFKEMLLTGKVMWGMMIYDSLSALD
YMQSRSDVQPDRIGTIGMSMGGLMAWWTAALDDRIKVCVDLCSQVDHHVL
IKTQNLDRHGFYYYVPSLAKHFSASEIQSLIAPRPHLSLVGVHDRLTPAE
GVDKIEKELTAVYAGQGAADCYRVVRSASGHFETAVIRHEAVRFLQKWL

Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)> Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A (- 140)
Ref: Nature, 390:249, 1997 : PubMed
Abstract


ESTHER: Kunst_1997_Nature_390_249
PubMedSearch: Kunst 1997 Nature 390 249
PubMedID: 9384377
Gene_locus related to this paper: bacsu-CAH, bacsu-cbxnp, bacsu-lip, bacsu-LIPB, bacsu-PKSR, bacsu-pnbae, bacsu-PPSE, bacsu-srf4, bacsu-srfac, bacsu-YBAC, bacsu-YBDG, bacsu-ybfk, bacsu-ycgS, bacsu-yczh, bacsu-YDEN, bacsu-ydjp, bacsu-yfhM, bacsu-yisY, bacsu-YITV, bacsu-yjau, bacsu-YJCH, bacsu-MHQD, bacsu-yqjl, bacsu-yqkd, bacsu-YRAK, bacsu-YTAP, bacsu-YTMA, bacsu-YTPA, bacsu-ytxm, bacsu-yugF, bacsu-YUII, bacsu-YUKL, bacsu-YVAK, bacsu-YvaM, bacsu-yvfQ

Abstract

Bacillus subtilis is the best-characterized member of the Gram-positive bacteria. Its genome of 4,214,810 base pairs comprises 4,100 protein-coding genes. Of these protein-coding genes, 53% are represented once, while a quarter of the genome corresponds to several gene families that have been greatly expanded by gene duplication, the largest family containing 77 putative ATP-binding transport proteins. In addition, a large proportion of the genetic capacity is devoted to the utilization of a variety of carbon sources, including many plant-derived molecules. The identification of five signal peptidase genes, as well as several genes for components of the secretion apparatus, is important given the capacity of Bacillus strains to secrete large amounts of industrially important enzymes. Many of the genes are involved in the synthesis of secondary metabolites, including antibiotics, that are more typically associated with Streptomyces species. The genome contains at least ten prophages or remnants of prophages, indicating that bacteriophage infection has played an important evolutionary role in horizontal gene transfer, in particular in the propagation of bacterial pathogenesis.



        

Title: Cloning, sequencing, and characterization of the Bacillus subtilis biotin biosynthetic operon
Bower S, Perkins JB, Yocum RR, Howitt CL, Rahaim P, Pero J
Ref: Journal of Bacteriology, 178:4122, 1996 : PubMed
Abstract


ESTHER: Bower_1996_J.Bacteriol_178_4122
PubMedSearch: Bower 1996 J.Bacteriol 178 4122
PubMedID: 8763940
Gene_locus related to this paper: bacsu-YTAP

Abstract

A 10-kb region of the Bacillus subtilis genome that contains genes involved in biotin-biosynthesis was cloned and sequenced. DNA sequence analysis indicated that B. subtilis contains homologs of the Escherichia coli and Bacillus sphaericus bioA, bioB, bioD, and bioF genes. These four genes and a homolog of the B. sphaericus bioW gene are arranged in a single operon in the order bioWAFDR and are followed by two additional genes, bioI and orf2. bioI and orf2 show no similarity to any other known biotin biosynthetic genes. The bioI gene encodes a protein with similarity to cytochrome P-450s and was able to complement mutations in either bioC or bioH of E. coli. Mutations in bioI caused B. subtilis to grow poorly in the absence of biotin. The bradytroph phenotype of bioI mutants was overcome by pimelic acid, suggesting that the product of bioI functions at a step prior to pimelic acid synthesis. The B. subtilis bio operon is preceded by a putative vegetative promoter sequence and contains just downstream a region of dyad symmetry with homology to the bio regulatory region of B. sphaericus. Analysis of a bioW-lacZ translational fusion indicated that expression of the biotin operon is regulated by biotin and the B. subtilis birA gene.