bacsu-yqjl

 
Bacillus subtilis hypothetical protein yqjl

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : D84432, Z99116
1 UniProt : P54549
1 UniProtTrembl : P54549
1 Interpro : P54549
1 Prodom : P54549
1 Pfam : P54549
1 PIRSF : P54549
1 SUPERFAM : P54549
1 QuickSwissBlast : P54549
 
Sequence
Graphical view for this peptide sequence: bacsu-yqjl
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKSAWMEKTYTIDGCAFHTQHRKGSSGVTIVFEAGYGTSSETWKPLMADI
DDEFGIFTYDRAGIGKSGQSRAKRTADQQVKELESLLKAADVKPPYLAVS
HSYGAVITGLWACKNKHDIIGMVLLDPALGDCASFTFIPEEMHKSHTRKM
MLEGTHAEFSKSLQELKKRQVHLGNMPLLVLSSGERTEKFAAEQEWQNLH
SSILSLSNQSGWIQAKNSSHNIHHDEPHIVHLAIYDVWCAACQQAAPLYQ
AVN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKSAWMEKTYTIDGCAFHTQHRKGSSGVTIVFEAGYGTSSETWKPLMADI
DDEFGIFTYDRAGIGKSGQSRAKRTADQQVKELESLLKAADVKPPYLAVS
HSYGAVITGLWACKNKHDIIGMVLLDPALGDCASFTFIPEEMHKSHTRKM
MLEGTHAEFSKSLQELKKRQVHLGNMPLLVLSSGERTEKFAAEQEWQNLH
SSILSLSNQSGWIQAKNSSHNIHHDEPHIVHLAIYDVWCAACQQAAPLYQ
AVN

no DNA




References
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Systematic sequencing of the 283 kb 210 degrees-232 degrees region of the Bacillus subtilis genome containing the skin element and many sporulation genes
    Mizuno M, Masuda S, Takemaru K, Hosono S, Sato T, Takeuchi M, Kobayashi Y
    Ref: Microbiology, 142 ( Pt 11):3103, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer