Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-ACHE

Bos taurus protein for acetylcholinesterase T subunit

Comment
Alternate Cterminus: T or H peptide F1MIM4 is a fragment with sequences differences pseudo gene?


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AF061813, AH006932, AF061815
2 UniProt : P23795, F1MIM4
>3 Ncbi-nid links 2 more: 3746575, 3746573, 3746572
>3 Ncbi-pid links 2 more: 113035, 108493, 226916
>3 UniProt links 2 more: Q9TSJ6, Q9TR27, P23795
>3 Interpro links 2 more: Q9TSJ6, Q9TR27, P23795
>3 Prodom links 2 more: Q9TSJ6, Q9TR27, P23795
>3 Pfam links 2 more: Q9TSJ6, Q9TR27, P23795
>3 PIRSF links 2 more: Q9TSJ6, Q9TR27, P23795
>3 SUPERFAM links 2 more: Q9TSJ6, Q9TR27, P23795
1 ENSEMBL : ENSBTAG00000001139
Sequence
Graphical view for this peptide sequence: bovin-ACHE
Colored MSA for ACHE (raw)
MRPPWCPLHTPSLTPPLLLLLFLIGGGAEAEGPEDPELLVMVRGGRLRGL
RLMAPRGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWPGVLNATAFQSVCY
QYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPSSPTPVLVWIYG
GGFYSGASSLDVYDGRFLTQAEGTVLVSMNYRVGAFGFLALPGSREAPGN
VGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRG
LFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQA
SDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAA
QGARVYAYIFEHRASTLSWPLWMGVPHGYEIEFIFGLPLEPSLNYTIEER
TFAQRLMRYWANFARTGDPNDPRDPKAPQWPPYTAGAQQYVSLNLRPLEV
RRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPPWCPLHTPSLTPPLLLLLFLIGGGAEAEGPEDPELLVMVRGGRLRGL
RLMAPRGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWPGVLNATAFQSVCY
QYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPSSPTPVLVWIYG
GGFYSGASSLDVYDGRFLTQAEGTVLVSMNYRVGAFGFLALPGSREAPGN
VGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRG
LFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQA
SDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAA
QGARVYAYIFEHRASTLSWPLWMGVPHGYEIEFIFGLPLEPSLNYTIEER
TFAQRLMRYWANFARTGDPNDPRDPKAPQWPPYTAGAQQYVSLNLRPLEV
RRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL


References
    Title: The genome sequence of taurine cattle: a window to ruminant biology and evolution
    Elsik CG, Tellam RL, Worley KC, Gibbs RA, Muzny DM, Weinstock GM, Adelson DL, Eichler EE, Elnitski L and Zhao FQ <297 more author(s)>
    Ref: Science, 324:522, 2009 : PubMed

            

    Title: Bovine acetylcholinesterase: cloning, expression and characterization
    Mendelson I, Kronman C, Ariel N, Shafferman A, Velan B
    Ref: Biochemical Journal, 334:251, 1998 : PubMed

            

    Title: Complete amino acid sequence of fetal bovine serum acetylcholinesterase and its comparison in various regions with other cholinesterases
    Doctor BP, Chapman TC, Christner CE, Deal CD, De La Hoz DM, Gentry MK, Ogert RA, Rush RS, Smyth KK, Wolfe AD
    Ref: FEBS Letters, 266:123, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer