Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-EPHX1

Mus musculus (Mouse) epoxide hydrolase mEH (EC 3.3.2.3)

Comment
Q8K2W5 Stausberg 4 aa different, Q6PEV0 1 del


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Cis-stilbene-oxide
2 inhibitors: 62-mEH, NSPA
>3 Genbank links 1 more: U89491, BC029636, AK018249
>3 UniProt links 1 more: Q9D379, Q6PEV0, Q8K2W5
>3 UniProt links 1 more: Q6PEV0, Q9D379, Q8K2W5
>3 Interpro links 1 more: Q6PEV0, Q9D379, Q8K2W5
>3 Pfam links 1 more: Q6PEV0, Q9D379, Q8K2W5
>3 PIRSF links 1 more: Q6PEV0, Q9D379, Q8K2W5
>3 SUPERFAM links 1 more: Q6PEV0, Q9D379, Q8K2W5
1 MGD : 95405
2 ENSEMBL : Q9D379, ENSMUSG00000038776
Sequence
Graphical view for this peptide sequence: mouse-EPHX1
Colored MSA for Epoxide_hydrolase (raw)
MWLELILASVLGFVIYWFVSRDKEETLPLEDGWWGPGSKPSAKEDESIRP
FKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSSYLKKVVSFWRNE
FDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGW
PGSFYEFYKIIPLLTDPKTHGLSDEHVFEVICPSIPGYGFSEASSKKGLN
SVATARIFYKLMSRLGFQKFYIQGGDWGSLICTNIAQMVPNHVKGLHLNM
SFISRNIYSLTPLLGQRFGRFLGYTEKDLELLYPFKEKVFYNIMRESGYL
HIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFS
LEDLLTNIMIYWTTGTIVSSQRFYKENLGQGVMVHRHEGMKVFVPTGYSA
FPSEILHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVS
LAELQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLELILASVLGFVIYWFVSRDKEETLPLEDGWWGPGSKPSAKEDESIRP
FKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSSYLKKVVSFWRNE
FDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGW
PGSFYEFYKIIPLLTDPKTHGLSDEHVFEVICPSIPGYGFSEASSKKGLN
SVATARIFYKLMSRLGFQKFYIQGGDWGSLICTNIAQMVPNHVKGLHLNM
SFISRNIYSLTPLLGQRFGRFLGYTEKDLELLYPFKEKVFYNIMRESGYL
HIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFS
LEDLLTNIMIYWTTGTIVSSQRFYKENLGQGVMVHRHEGMKVFVPTGYSA
FPSEILHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVS
LAELQ


References
3 more
    Title: Development of potent inhibitors of the human microsomal epoxide hydrolase
    Barnych B, Singh N, Negrel S, Zhang Y, Magis D, Roux C, Hua X, Ding Z, Morisseau C and Hammock BD <2 more author(s)>
    Ref: Eur Journal of Medicinal Chemistry, 193:112206, 2020 : PubMed

            

    Title: Beyond detoxification: a role for mouse mEH in the hepatic metabolism of endogenous lipids
    Marowsky A, Meyer I, Erismann-Ebner K, Pellegrini G, Mule N, Arand M
    Ref: Archives of Toxicology, 91:3571, 2017 : PubMed

            

    Title: The Ephx1(d) allele encoding an Arg338Cys substitution is associated with heat lability
    Hartsfield JK, Jr., Everett ET
    Ref: Mamm Genome, 11:915, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer