Mus musculus (Mouse) hypothetical Maspardin-ACP33-SPG21 Spg21 Spastic paraplegia 21 homolog (Human)
Mus musculus (Mouse) dna segment, chr 9, wayne state university 18, expressed, Q8C1Y7 and Q9CQC8 differ at the C-term end IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP replaced by VSPAWTPEHVRFRDPPQDSAP
Family : Maspardin-ACP33-SPG21_like
Block : X
Position in NCBI Life Tree : Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Deuterostomia N E > Chordata N E > Craniata N E > Vertebrata N E > Gnathostomata N E > Teleostomi N E > Euteleostomi N E > Sarcopterygii N E > Dipnotetrapodomorpha N E > Tetrapoda N E > Amniota N E > Mammalia N E > Theria N E > Eutheria N E > Boreoeutheria N E > Euarchontoglires N E > Glires N E > Rodentia N E > Myomorpha N E > Muroidea N E > Muridae N E > Murinae N E > Mus [genus] N E > Mus [subgenus] N E > Mus musculus N E > cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Deuterostomia N E > Chordata N E > Craniata N E > Vertebrata N E > Gnathostomata N E > Teleostomi N E > Euteleostomi N E > Sarcopterygii N E > Dipnotetrapodomorpha N E > Tetrapoda N E > Amniota N E > Mammalia N E > Theria N E > Eutheria N E > Boreoeutheria N E > Euarchontoglires N E > Glires N E > Rodentia N E > Myomorpha N E > Muroidea N E > Muridae N E > Murinae N E > Mus [genus] N E > Mus [subgenus] N E > Mus musculus N E > cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Deuterostomia N E > Chordata N E > Craniata N E > Vertebrata N E > Gnathostomata N E > Teleostomi N E > Euteleostomi N E > Sarcopterygii N E > Dipnotetrapodomorpha N E > Tetrapoda N E > Amniota N E > Mammalia N E > Theria N E > Eutheria N E > Boreoeutheria N E > Euarchontoglires N E > Glires N E > Rodentia N E > Myomorpha N E > Muroidea N E > Muridae N E > Murinae N E > Mus [genus] N E > Mus [subgenus] N E > Mus musculus N EMGEIKVSPDY NWFRSTVPLK KIIVDDDDSK IWSLYDAGPR SIRCPLIFLP PVSGTADVFF QQILALTGWG YRVIALQYPV YWDHLEFCDG FRKLLDHLQL DKVHLFGASL GGFLAQKFAE YTHKSPRVHS LILCNAFSDT SIFNQTWTAN SFWLMPAFML KKIVLGNFSS GPVDPMMADA IDFMVDRLES LGQSELASRL TLNCQNSYVE PHKIRDIPVT IMDVFDQSAL STEAKEEMYK LYPNARRAHL KTGGNFPYLC RSAEVNLYVQ IHLLQFHGTK YAAIDPSVVS AEELEVQKGR LGLSQEEP
| Title : Loss of Maspardin Attenuates the Growth and Maturation of Mouse Cortical Neurons - Davenport_2016_Neurodegener.Dis_16_260 |
| Author(s) : Davenport A , Bivona A , Latson W , Lemanski LF , Cheriyath V |
| Ref : Neurodegener Dis , 16 :260 , 2016 |
| Abstract : |
| PubMedSearch : Davenport_2016_Neurodegener.Dis_16_260 |
| PubMedID: 26978163 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Loss of Maspardin Attenuates the Growth and Maturation of Mouse Cortical Neurons - Davenport_2016_Neurodegener.Dis_16_260 |
| Author(s) : Davenport A , Bivona A , Latson W , Lemanski LF , Cheriyath V |
| Ref : Neurodegener Dis , 16 :260 , 2016 |
| Abstract : |
| PubMedSearch : Davenport_2016_Neurodegener.Dis_16_260 |
| PubMedID: 26978163 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Loss of Maspardin Attenuates the Growth and Maturation of Mouse Cortical Neurons - Davenport_2016_Neurodegener.Dis_16_260 |
| Author(s) : Davenport A , Bivona A , Latson W , Lemanski LF , Cheriyath V |
| Ref : Neurodegener Dis , 16 :260 , 2016 |
| Abstract : |
| PubMedSearch : Davenport_2016_Neurodegener.Dis_16_260 |
| PubMedID: 26978163 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Targeted disruption of the Mast syndrome gene SPG21 in mice impairs hind limb function and alters axon branching in cultured cortical neurons - Soderblom_2010_Neurogenetics_11_369 |
| Author(s) : Soderblom C , Stadler J , Jupille H , Blackstone C , Shupliakov O , Hanna MC |
| Ref : Neurogenetics , 11 :369 , 2010 |
| Abstract : |
| PubMedSearch : Soderblom_2010_Neurogenetics_11_369 |
| PubMedID: 20661613 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Targeted disruption of the Mast syndrome gene SPG21 in mice impairs hind limb function and alters axon branching in cultured cortical neurons - Soderblom_2010_Neurogenetics_11_369 |
| Author(s) : Soderblom C , Stadler J , Jupille H , Blackstone C , Shupliakov O , Hanna MC |
| Ref : Neurogenetics , 11 :369 , 2010 |
| Abstract : |
| PubMedSearch : Soderblom_2010_Neurogenetics_11_369 |
| PubMedID: 20661613 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Targeted disruption of the Mast syndrome gene SPG21 in mice impairs hind limb function and alters axon branching in cultured cortical neurons - Soderblom_2010_Neurogenetics_11_369 |
| Author(s) : Soderblom C , Stadler J , Jupille H , Blackstone C , Shupliakov O , Hanna MC |
| Ref : Neurogenetics , 11 :369 , 2010 |
| Abstract : |
| PubMedSearch : Soderblom_2010_Neurogenetics_11_369 |
| PubMedID: 20661613 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Interaction of the SPG21 protein ACP33\/maspardin with the aldehyde dehydrogenase ALDH16A1 - Hanna_2009_Neurogenetics_10_217 |
| Author(s) : Hanna MC , Blackstone C |
| Ref : Neurogenetics , 10 :217 , 2009 |
| Abstract : |
| PubMedSearch : Hanna_2009_Neurogenetics_10_217 |
| PubMedID: 19184135 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Interaction of the SPG21 protein ACP33\/maspardin with the aldehyde dehydrogenase ALDH16A1 - Hanna_2009_Neurogenetics_10_217 |
| Author(s) : Hanna MC , Blackstone C |
| Ref : Neurogenetics , 10 :217 , 2009 |
| Abstract : |
| PubMedSearch : Hanna_2009_Neurogenetics_10_217 |
| PubMedID: 19184135 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Interaction of the SPG21 protein ACP33\/maspardin with the aldehyde dehydrogenase ALDH16A1 - Hanna_2009_Neurogenetics_10_217 |
| Author(s) : Hanna MC , Blackstone C |
| Ref : Neurogenetics , 10 :217 , 2009 |
| Abstract : |
| PubMedSearch : Hanna_2009_Neurogenetics_10_217 |
| PubMedID: 19184135 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Cloning of ACP33 as a novel intracellular ligand of CD4 - Zeitlmann_2001_J.Biol.Chem_276_9123 |
| Author(s) : Zeitlmann L , Sirim P , Kremmer E , Kolanus W |
| Ref : Journal of Biological Chemistry , 276 :9123 , 2001 |
| Abstract : |
| PubMedSearch : Zeitlmann_2001_J.Biol.Chem_276_9123 |
| PubMedID: 11113139 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Cloning of ACP33 as a novel intracellular ligand of CD4 - Zeitlmann_2001_J.Biol.Chem_276_9123 |
| Author(s) : Zeitlmann L , Sirim P , Kremmer E , Kolanus W |
| Ref : Journal of Biological Chemistry , 276 :9123 , 2001 |
| Abstract : |
| PubMedSearch : Zeitlmann_2001_J.Biol.Chem_276_9123 |
| PubMedID: 11113139 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |
| Title : Cloning of ACP33 as a novel intracellular ligand of CD4 - Zeitlmann_2001_J.Biol.Chem_276_9123 |
| Author(s) : Zeitlmann L , Sirim P , Kremmer E , Kolanus W |
| Ref : Journal of Biological Chemistry , 276 :9123 , 2001 |
| Abstract : |
| PubMedSearch : Zeitlmann_2001_J.Biol.Chem_276_9123 |
| PubMedID: 11113139 |
| Gene_locus related to this paper: human-SPG21 , mouse-SPG21 |