Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-dpp4

M.musculus mRNA for dipeptidyl peptidase IV

Comment
Belongs to peptidase family s9B


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
ABP-C6
>3 Genbank links 4 more: X58384, U12620, AK163085
2 UniProt : P28843, Q3TR43
1 Ncbi-nid : 550374
1 Ncbi-pid : 550375
2 UniProt : P28843, Q3TR43
2 Interpro : P28843, Q3TR43
2 Prodom : P28843, Q3TR43
2 Pfam : P28843, Q3TR43
2 PIRSF : P28843, Q3TR43
2 SUPERFAM : P28843, Q3TR43
1 MGD : 94919
2 ENSEMBL : P28843, ENSMUSG00000035000
Sequence
Graphical view for this peptide sequence: mouse-dpp4
Colored MSA for DPP4N_Peptidase_S9 (raw)
MKTPWKVLLGLLGVAALVTIITVPIVLLSKDEAAADSRRTYSLADYLKST
FRVKSYSLWWVSDFEYLYKQENNILLLNAEHGNSSIFLENSTFESFGYHS
VSPDRLFVLLEYNYVKQWRHSYTASYNIYDVNKRQLITEEKIPNNTQWIT
WSPEGHKLAYVWKNDIYVKVEPHLPSHRITSTGEENVIYNGITDWVYEEE
VFGAYSALWWSPNNTFLAYAQFNDTGVPLIEYSFYSDESLQYPKTVWIPY
PKAGAVNPTVKFFIVNIDSLSSSSSAAPIQIPAPASVARGDHYLCDVVWA
TEERISLQWLRRIQNYSVMAICDYDKINLTWNCPSEQQHVEMSTTGWVGR
FRPAEPHFTSDGSSFYKIISDKDGYKHICHFPKDKKDCTFITKGAWEVIS
IEALTSDYLYYISNQYKEMPGGRNLYKIQLTDHTNVKCLSCDLNPERCQY
YAVSFSKEAKYYQLGCWGPGLPLYTLHRSTDHKELRVLEDNSALDRMLQD
VQMPSKKLDFIVLNETRFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKAD
ASFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTLEVEDQ
IEAARQFVKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPV
SRWEYYDSVYTERYMGLPIPEDNLDHYRNSTVMSRAEHFKQVEYLLIHGT
ADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMS
HFLQQCFSLH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTPWKVLLGLLGVAALVTIITVPIVLLSKDEAAADSRRTYSLADYLKST
FRVKSYSLWWVSDFEYLYKQENNILLLNAEHGNSSIFLENSTFESFGYHS
VSPDRLFVLLEYNYVKQWRHSYTASYNIYDVNKRQLITEEKIPNNTQWIT
WSPEGHKLAYVWKNDIYVKVEPHLPSHRITSTGEENVIYNGITDWVYEEE
VFGAYSALWWSPNNTFLAYAQFNDTGVPLIEYSFYSDESLQYPKTVWIPY
PKAGAVNPTVKFFIVNIDSLSSSSSAAPIQIPAPASVARGDHYLCDVVWA
TEERISLQWLRRIQNYSVMAICDYDKINLTWNCPSEQQHVEMSTTGWVGR
FRPAEPHFTSDGSSFYKIISDKDGYKHICHFPKDKKDCTFITKGAWEVIS
IEALTSDYLYYISNQYKEMPGGRNLYKIQLTDHTNVKCLSCDLNPERCQY
YAVSFSKEAKYYQLGCWGPGLPLYTLHRSTDHKELRVLEDNSALDRMLQD
VQMPSKKLDFIVLNETRFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKAD
ASFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTLEVEDQ
IEAARQFVKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPV
SRWEYYDSVYTERYMGLPIPEDNLDHYRNSTVMSRAEHFKQVEYLLIHGT
ADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMS
HFLQQCFSLH


References
1 more
    Title: Mice lacking dipeptidyl peptidase IV are protected against obesity and insulin resistance
    Conarello SL, Li Z, Ronan J, Roy RS, Zhu L, Jiang G, Liu F, Woods J, Zycband E and Zhang BB <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:6825, 2003 : PubMed

            

    Title: Structure of the mouse dipeptidyl peptidase IV (CD26) gene
    Bernard AM, Mattei MG, Pierres M, Marguet D
    Ref: Biochemistry, 33:15204, 1994 : PubMed

            

    Title: cDNA cloning for mouse thymocyte-activating molecule. A multifunctional ecto-dipeptidyl peptidase IV (CD26) included in a subgroup of serine proteases
    Marguet D, Bernard AM, Vivier I, Darmoul D, Naquet P and
    Ref: Journal of Biological Chemistry, 267:2200, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer