Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-pir7b

Oryza sativa (Rice) Oryza glaberrima (African rice) pir7b protein

Comment
Other strains: Oryza sativa (Rice) (japonica cultivar-group; subsp. indica) Oryza glaberrima (African rice)


Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: Z34271, Z34270, AP003246
>3 UniProt links 2 more: Q0JG99, A2WYS7, A3A199
>3 UniProt links 2 more: Q0JG99, A2WYS7, A3A199
>3 Interpro links 2 more: Q0JG99, A2WYS7, A3A199
>3 Pfam links 2 more: Q0JG99, A2WYS7, A3A199
>3 PIRSF links 2 more: Q0JG99, A2WYS7, A3A199
>3 SUPERFAM links 2 more: Q0JG99, A2WYS7, A3A199
Sequence
Graphical view for this peptide sequence: orysa-pir7b
Colored MSA for Hydroxynitrile_lyase (raw)
MEISSSSKKHFILVHGLCHGAWCWYRVVAALRAAGHRATALDMAASGAHP
ARVDEVGTFEEYSRPLLDAVAAAAAPGERLVLVGHSHGGLSVALAMERFP
DKVAAAVFVAAAMPCVGKHMGVPTEEFMRRTAPEGLLMDCEMVAINNSQG
SGVAINLGPTFLAQKYYQQSPAEDLALAKMLVRPGNQFMDDPVMKDESLL
TNGNYGSVKKVYVIAKADSSSTEEMQRWMVAMSPGTDVEEIAGADHAVMN
SKPRELCDILIKIANKYE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEISSSSKKHFILVHGLCHGAWCWYRVVAALRAAGHRATALDMAASGAHP
ARVDEVGTFEEYSRPLLDAVAAAAAPGERLVLVGHSHGGLSVALAMERFP
DKVAAAVFVAAAMPCVGKHMGVPTEEFMRRTAPEGLLMDCEMVAINNSQG
SGVAINLGPTFLAQKYYQQSPAEDLALAKMLVRPGNQFMDDPVMKDESLL
TNGNYGSVKKVYVIAKADSSSTEEMQRWMVAMSPGTDVEEIAGADHAVMN
SKPRELCDILIKIANKYE


References
1 more
    Title: The genome sequence and structure of rice chromosome 1
    Sasaki T, Matsumoto T, Yamamoto K, Sakata K, Baba T, Katayose Y, Wu J, Niimura Y, Cheng Z and Gojobori T <69 more author(s)>
    Ref: Nature, 420:312, 2002 : PubMed

            

    Title: The defense-related rice gene Pir7b encodes an alpha/beta hydrolase fold protein exhibiting esterase activity towards naphthol AS-esters
    Waspi U, Misteli B, Hasslacher M, Jandrositz A, Kohlwein SD, Schwab H, Dudler R
    Ref: European Journal of Biochemistry, 254:32, 1998 : PubMed

            

    Title: Characterization of a rice gene induced by Pseudomonas syringae pv. syringae: requirement for the bacterial lemA gene function.
    Reimmann C, Mauch F, Dudler R, Hofmann C
    Ref: Physiol Mol Plant Pathol, 46:71, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer