Gene_locus Report for: orysi-a2zef2

Oryza sativa subsp. indica subsp. japonica (Rice) Putative uncharacterized protein

Relationship

Family	\|	Hydroxynitrile_lyase
Block	\|	X
Position in NCBI Life Tree	\|	Oryza sativa subsp. indica

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E > Oryza sativa Indica Group: N E

There are 9 a/b hydrolases in Oryza sativa subsp. indica view in a: Table

Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		>3 Genbank links 1 more: CM000136, CM000148, DP000010 >3 UniProt links 1 more: A2ZEF2, A3CBE6, Q2R416 >3 UniProt links 1 more: A2ZEF2, A3CBE6, Q2R416 >3 Interpro links 1 more: A2ZEF2, A3CBE6, Q2R416 >3 Pfam links 1 more: A2ZEF2, A3CBE6, Q2R416 >3 PIRSF links 1 more: A2ZEF2, A3CBE6, Q2R416 >3 SUPERFAM links 1 more: A2ZEF2, A3CBE6, Q2R416

Sequence

Peptide

Graphical view for this peptide sequence: orysi-a2zef2
Colored MSA for Hydroxynitrile_lyase (raw)
MSSPETTTDQSGSNKQQRRRRRHHFILVHGVCHGAWCWYRVATALSSAGH RVTALDMAACGARPGRADEVPSFERYTAPLLDAVADQDGEEKAVVVAHSF GGQSLALAMERHPEKIAVAVFVTATMPAAGKSMSFAFKQLSQGKDADFFM DCTIRTIGDPQNPDKTFLFGPEYLARRVYQLSPPEDLALAMSTVRPSRRF LNDATMNGDVLTEGRYGTVRRVYVVAEEDEWKPAEIQRLMVSWNPGTEVR ALQGADHMPMFSKARELSELLMEIANKYS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSSPETTTDQSGSNKQQRRRRRHHFILVHGVCHGAWCWYRVATALSSAGH
RVTALDMAACGARPGRADEVPSFERYTAPLLDAVADQDGEEKAVVVAHSF
GGQSLALAMERHPEKIAVAVFVTATMPAAGKSMSFAFKQLSQGKDADFFM
DCTIRTIGDPQNPDKTFLFGPEYLARRVYQLSPPEDLALAMSTVRPSRRF
LNDATMNGDVLTEGRYGTVRRVYVVAEEDEWKPAEIQRLMVSWNPGTEVR
ALQGADHMPMFSKARELSELLMEIANKYS

References

3 more

Title:

Matsumo T, Sasaki T

Ref:

436

PubMed

Title:

Rice Chromosomes 11 and 12 Sequencing Consortia

Ref:

PubMed

ESTHER: Messing_2005_BMC.Biol_3_20
PubMedSearch: Messing 2005 BMC.Biol 3 20
PubMedID: 16188032
Gene_locus related to this paper: orysi-a2zef2

Abstract

BACKGROUND: Rice is an important staple food and, with the smallest cereal genome, serves as a reference species for studies on the evolution of cereals and other grasses. Therefore, decoding its entire genome will be a prerequisite for applied and basic research on this species and all other cereals.
RESULTS: We have determined and analyzed the complete sequences of two of its chromosomes, 11 and 12, which total 55.9 Mb (14.3% of the entire genome length), based on a set of overlapping clones. A total of 5,993 non-transposable element related genes are present on these chromosomes. Among them are 289 disease resistance-like and 28 defense-response genes, a higher proportion of these categories than on any other rice chromosome. A three-Mb segment on both chromosomes resulted from a duplication 7.7 million years ago (mya), the most recent large-scale duplication in the rice genome. Paralogous gene copies within this segmental duplication can be aligned with genomic assemblies from sorghum and maize. Although these gene copies are preserved on both chromosomes, their expression patterns have diverged. When the gene order of rice chromosomes 11 and 12 was compared to wheat gene loci, significant synteny between these orthologous regions was detected, illustrating the presence of conserved genes alternating with recently evolved genes. CONCLUSION: Because the resistance and defense response genes, enriched on these chromosomes relative to the whole genome, also occur in clusters, they provide a preferred target for breeding durable disease resistance in rice and the isolation of their allelic variants. The recent duplication of a large chromosomal segment coupled with the high density of disease resistance gene clusters makes this the most recently evolved part of the rice genome. Based on syntenic alignments of these chromosomes, rice chromosome 11 and 12 do not appear to have resulted from a single whole-genome duplication event as previously suggested.

Title:

Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>

Ref:

PubMed

Other Papers

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer