Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysj-q9fwm6

Oryza sativa subsp. japonica (Rice) subsp. indica (Rice); Oryza glaberrima (African rice) Os10g0550500 Putative pectin acetylesterase

Comment
Other strains: Oryza sativa subsp. japonica (Rice) subsp. indica (Rice)Oryza glaberrima (African rice)(fragment)


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AC026758, AP008216, DP000086
>3 UniProt links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
>3 UniProt links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
>3 Interpro links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
>3 Prodom links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
>3 Pfam links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
>3 PIRSF links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
>3 SUPERFAM links 3 more: Q9FWM6, Q0IVV9, Q7XCE7
Sequence
Graphical view for this peptide sequence: orysj-q9fwm6
Colored MSA for Pectinacetylesterase-Notum (raw)
MAQRHWPWRLAVFVAAVVTPVAAEERLVVGMTLLQAATSTGAGEEFFLFF
FFLLFFFFFFSVCDFLVFDRLHCTAANRWRVCLDGSPPAYHLHRGSGGGA
GGWVLQFEGGGWCNDAPSCAERAGTRRGSTRSMDSLEVFSGLLSNDPDMN
PDFYNWNRVKLRYCDGGSFAGDSELRNGSSVLYFRGQRIWDAIISDLLPK
GLAKAQKVLLSGCSAGGLATFFHCDDLKGRLGDAVTVKCLSDAGFFLDVD
DITGNNTVEPFFRSLVALQFHHNFVHPSCDPKGQWSHCKSDPGACSTSQI
ATLQGLRNAMLTALKPFQNEQGVGMFINSCFAHCQSELQETWLAPNSPRL
HNKTIAELVGEWYFERGPGIEIDCAYPCDSTCHNIIPSNQELGI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAQRHWPWRLAVFVAAVVTPVAAEERLVVGMTLLQAATSTGAGEEFFLFF
FFLLFFFFFFSVCDFLVFDRLHCTAANRWRVCLDGSPPAYHLHRGSGGGA
GGWVLQFEGGGWCNDAPSCAERAGTRRGSTRSMDSLEVFSGLLSNDPDMN
PDFYNWNRVKLRYCDGGSFAGDSELRNGSSVLYFRGQRIWDAIISDLLPK
GLAKAQKVLLSGCSAGGLATFFHCDDLKGRLGDAVTVKCLSDAGFFLDVD
DITGNNTVEPFFRSLVALQFHHNFVHPSCDPKGQWSHCKSDPGACSTSQI
ATLQGLRNAMLTALKPFQNEQGVGMFINSCFAHCQSELQETWLAPNSPRL
HNKTIAELVGEWYFERGPGIEIDCAYPCDSTCHNIIPSNQELGI


References
2 more
    Title: Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana
    Itoh T, Tanaka T, Barrero RA, Yamasaki C, Fujii Y, Hilton PB, Antonio BA, Aono H, Apweiler R and Sasaki T <85 more author(s)>
    Ref: Genome Res, 17:175, 2007 : PubMed

            

    Title: The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information
    Ohyanagi H, Tanaka T, Sakai H, Shigemoto Y, Yamaguchi K, Habara T, Fujii Y, Antonio BA, Nagamura Y and Sasaki T <4 more author(s)>
    Ref: Nucleic Acids Research, 34:D741, 2006 : PubMed

            

    Title: The map-based sequence of the rice genome.
    Matsumo T, Sasaki T
    Ref: Nature, 436:793, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer