Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schpo-SPCC417.12

Schizosaccharomyces pombe (Fission yeast) hypothetical 59.2 kda protein c417.12 in chromosome III

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Schizosaccharomyces pombe
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > Taphrinomycotina: N E > Schizosaccharomycetes: N E > Schizosaccharomycetales: N E > Schizosaccharomycetaceae: N E > Schizosaccharomyces: N E > Schizosaccharomyces pombe: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL035076, NC_003421, CU329672
1 UniProt : O94493
1 Ncbi-nid : 4107289
1 UniProt : O94493
1 Interpro : O94493
1 Prodom : O94493
1 Pfam : O94493
1 PIRSF : O94493
1 SUPERFAM : O94493
Sequence
Graphical view for this peptide sequence: schpo-SPCC417.12
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MGVLHGLTVLDENGKEKCHRFTGIRYAKPPVGKLRWRRPVTLEDGYDYSG
DYNQFKTICPQPFYNNRKNQVRNPDFKYDEDCLFLNIWVPAGEKPAEGWP
VLYFIHGGWLQVGNPLHYRQCDPQDLQADGSPAKFILVSPGHRLNLFGFL
AGKELLEEDPKSSNFGFWDQRLGLEWTYKHIESFGGNKENIAVGGISAGS
YSALFQLIYETYHPEANQIIKRALLLSNGLSVQPKSVEESQIQFNELAQK
FGIPLELSSAEKLEKLRAIPFQDLADNILNLRLHTFRAVTDGDFVNPNTF
KDIYDGTFGKRIRDSGRELIIGEVNNEHSIYANTNPPKSKEDLFNQVNNY
YPEKVTKALLELYPKVPDMEDEKEYLAAIKALFGSIVSDMQVYASTRVLI
NGLVKGGVPLEKIYRYRIAFRGKFFDKYEPPESLVPHAGDLGLWFYNVVD
GILPEEIPIYKAWLKSYGEWMSTGKTDWGTTKTEEYRLLDADGTIKVVDD
EKWDWGLKVGRTVAGVFGLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVLHGLTVLDENGKEKCHRFTGIRYAKPPVGKLRWRRPVTLEDGYDYSG
DYNQFKTICPQPFYNNRKNQVRNPDFKYDEDCLFLNIWVPAGEKPAEGWP
VLYFIHGGWLQVGNPLHYRQCDPQDLQADGSPAKFILVSPGHRLNLFGFL
AGKELLEEDPKSSNFGFWDQRLGLEWTYKHIESFGGNKENIAVGGISAGS
YSALFQLIYETYHPEANQIIKRALLLSNGLSVQPKSVEESQIQFNELAQK
FGIPLELSSAEKLEKLRAIPFQDLADNILNLRLHTFRAVTDGDFVNPNTF
KDIYDGTFGKRIRDSGRELIIGEVNNEHSIYANTNPPKSKEDLFNQVNNY
YPEKVTKALLELYPKVPDMEDEKEYLAAIKALFGSIVSDMQVYASTRVLI
NGLVKGGVPLEKIYRYRIAFRGKFFDKYEPPESLVPHAGDLGLWFYNVVD
GILPEEIPIYKAWLKSYGEWMSTGKTDWGTTKTEEYRLLDADGTIKVVDD
EKWDWGLKVGRTVAGVFGLN


References
    Title: ORFeome cloning and global analysis of protein localization in the fission yeast Schizosaccharomyces pombe
    Matsuyama A, Arai R, Yashiroda Y, Shirai A, Kamata A, Sekido S, Kobayashi Y, Hashimoto A, Hamamoto M and Yoshida M <2 more author(s)>
    Ref: Nat Biotechnol, 24:841, 2006 : PubMed

            

    Title: The genome sequence of Schizosaccharomyces pombe
    Wood V, Gwilliam R, Rajandream MA, Lyne M, Lyne R, Stewart A, Sgouros J, Peat N, Hayles J and Nurse P <124 more author(s)>
    Ref: Nature, 415:871, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer